PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009592074.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 436aa    MW: 47928.6 Da    PI: 4.8979
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009592074.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS367.22.3e-112754333374
            GRAS   3 elLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshlt 97 
                      lLl+cAe+v+ ++l  a +lL ++ el+sp g++ +R+aayf+eAL+ar+ +s  + y+ l+ ++ + ++s++ ++al+ ++ +sP++kfsh t
  XP_009592074.1  75 GLLLQCAECVAMENLDDAGNLLPEIAELSSPFGSSAERVAAYFAEALSARIISSHLRFYSPLNLKTLTLTHSQKLFTALQSYNTISPLIKFSHYT 169
                     58********************************************************************************************* PP

            GRAS  98 aNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                     aNqaI++a+ege++vH+iD+di+qGlQWp L+q L+sR+++  s++iTgvgs    s e le+tg+rL++fA+++g+pfef++l  k  +  +l+
  XP_009592074.1 170 ANQAIYQALEGEDHVHVIDLDIMQGLQWPGLFQILSSRSRKLRSVKITGVGS----SMELLESTGRRLTEFANSFGLPFEFKPLEGKIGNITDLS 260
                     ****************************************************....***************************988888888*** PP

            GRAS 193 eLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerikvEr 287
                     +L vk gE+++Vn+++  h l+d ++s       + +l+  l+Pk+++++eq+++h ++sFl rf+eal+yysalfd+l  +l+ es er++vE+
  XP_009592074.1 261 QLGVKMGETIIVNWMH--HCLYDITGSDLG----TFRLLTLLQPKLITIIEQDLSH-GGSFLGRFVEALHYYSALFDALGDGLSVESVERHTVEQ 348
                     ***************9..777766777777....99********************.789*********************************** PP

            GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +l+g ei+n+va  g +r+ +   +e+W + l++ GF pv+ls + a+qa+lll +++ +gy++ ee+g+l lgWkd +L+++SaW+
  XP_009592074.1 349 QLFGCEIRNIVAVGGPKRTGEVP-VERWGDELKRIGFLPVSLSGTPAAQASLLLGMFP-KGYTLVEENGCLKLGWKDLSLLTASAWQ 433
                     *****************887765.9*********************************.9**************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098555.65847414IPR005202Transcription factor GRAS
PfamPF035147.9E-11075433IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048366Biological Processleaf development
GO:0090610Biological Processbundle sheath cell fate specification
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 436 aa     Download sequence    Send to blast
MLQSLQFSVS ASASASNSSS SMSSKRSIVD FTPVPSDEDP LHLTKRPRNN EEEQFEEGED  60
QLPVDTDSVG LRLLGLLLQC AECVAMENLD DAGNLLPEIA ELSSPFGSSA ERVAAYFAEA  120
LSARIISSHL RFYSPLNLKT LTLTHSQKLF TALQSYNTIS PLIKFSHYTA NQAIYQALEG  180
EDHVHVIDLD IMQGLQWPGL FQILSSRSRK LRSVKITGVG SSMELLESTG RRLTEFANSF  240
GLPFEFKPLE GKIGNITDLS QLGVKMGETI IVNWMHHCLY DITGSDLGTF RLLTLLQPKL  300
ITIIEQDLSH GGSFLGRFVE ALHYYSALFD ALGDGLSVES VERHTVEQQL FGCEIRNIVA  360
VGGPKRTGEV PVERWGDELK RIGFLPVSLS GTPAAQASLL LGMFPKGYTL VEENGCLKLG  420
WKDLSLLTAS AWQPCD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-45734334375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009592074.10.0PREDICTED: scarecrow-like protein 23
SwissprotQ9FHZ11e-174SCL23_ARATH; Scarecrow-like protein 23
TrEMBLM1AUK90.0M1AUK9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000306520.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107452126
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G41920.11e-161GRAS family protein