PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591935.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family FAR1
Protein Properties Length: 753aa    MW: 86050.1 Da    PI: 7.4952
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591935.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR199.82.9e-3163151291
            FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHelap 91 
                     fYn+YA++vGF +r+s+ ++s+r+++i +r+fvCskeg++ + +++ +k rr+r ++r+gCka+l+vkk+ +gkw +tk++++HnHel+p
  XP_009591935.1  63 FYNSYARRVGFGTRVSAYRRSRRDNTISSRQFVCSKEGFNPRPDEQ-HKPRRQRIVSRVGCKAHLTVKKQASGKWAITKFVKDHNHELVP 151
                     9***************************************999999.99***************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.2E-2863151IPR004330FAR1 DNA binding domain
PfamPF105517.7E-28269359IPR018289MULE transposase domain
PROSITE profilePS5096611.066553585IPR007527Zinc finger, SWIM-type
PfamPF044345.0E-10557584IPR007527Zinc finger, SWIM-type
SMARTSM005755.1E-9560587IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 753 aa     Download sequence    Send to blast
MESQPLNLES DAIEFDVGSG EEEEEEDYKH NSSGLDSGER CSSSDLEPYE GMEFESEQAA  60
RIFYNSYARR VGFGTRVSAY RRSRRDNTIS SRQFVCSKEG FNPRPDEQHK PRRQRIVSRV  120
GCKAHLTVKK QASGKWAITK FVKDHNHELV PPDQVHLLRS HRHVSGPARS LIDTLQAAGL  180
GATRVMSVLI KQSGGINNVG FTKSDCQNYM NQTRQRTLGT GAHYILEYLK QKQAEDPGFF  240
YVVQGGPSGN IFWADSTSRM NYSYFGDTVT FDTTYRTHRF RVPFAPFIGV NHHFQPVLFG  300
CALLLNESES SFIWLFQNWL AAMSGRHPVS ITTDHDRIIR SAIADVFPGA RHRFCKSNIF  360
RQVQERLSHS LQSFPLFEAE FQKCVNSTET IEEFELRWES LLGRYNHKDD EWLHSMYDAR  420
QHWVPVYLRD TFFGETSIAK TSDSTNSFFD GYIDASTNIH ILMTQYEKAT ASRHEKEVKA  480
ENDIINIAPI LKTPSPMEKQ AANVYTREIF LLFQRELMET LAYPATVIND TGPDVVYQVA  540
KFGEDHKVHY VQYNVFEKKG SCSCQLFDFS GIPCKHILAV FRVKNVLRLP SHYILKRWTR  600
KAKSEVVLDE DDLGLPSSHN ESFTARFEKL SLEATKYVKE GVDSEKVYQV SMNALREASK  660
KVAAAMCSTP APPQNLDMNK AKKLSLNGNQ DDCRVSCLVS QDEKIQELTT AVVNATEICE  720
AYRAKLLSIL REMEEQKLRI SLKVQSMRLN QMT
Functional Description ? help Back to Top
Source Description
UniProtPutative transcription activator involved in regulating light control of development.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in hypocotyls by far-red light treatment. {ECO:0000269|PubMed:15591448}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754430.0HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591935.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
RefseqXP_009591996.10.0PREDICTED: protein FAR1-RELATED SEQUENCE 5-like
SwissprotQ9SZL80.0FRS5_ARATH; Protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A1S3ZJB90.0A0A1S3ZJB9_TOBAC; protein FAR1-RELATED SEQUENCE 5-like
STRINGXP_009591935.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.10.0FAR1-related sequence 5
Publications ? help Back to Top
  1. Joly-Lopez Z, et al.
    Abiotic Stress Phenotypes Are Associated with Conserved Genes Derived from Transposable Elements.
    Front Plant Sci, 2017. 8: p. 2027
    [PMID:29250089]