PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009591500.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 754aa    MW: 82578.3 Da    PI: 5.6059
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009591500.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS330.14.2e-1013927532374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     +++L+++Ae v++g+  laq +Larl+++ sp g+p+ R+a+y +eAL+  l+ ++++l +   ps++ + + + ++ a+k fse+sP+ +f+++
  XP_009591500.1 392 IDQLFKAAELVQTGNPVLAQGILARLNHQLSPIGKPFYRAAFYCKEALQLLLHTNTNNLNNPSIPSSS-PFSLIFKIGAYKSFSEISPVAQFANF 485
                     689***************************************************88888876655544.467*********************** PP

            GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlel 191
                     t+Nqa+le ++g er+Hi+Dfdi++G QW++L+q+La R++g+p+l+iT+++sp+++++ el  t+e L +fA+e++++fef++l  ++l++   
  XP_009591500.1 486 TCNQALLEVLDGFERIHIVDFDIGYGRQWASLMQELALRSGGAPTLKITALASPSTHDQLELGLTRESLIHFANEINMEFEFEILSIDSLNST-S 579
                     ************************************************************************************977766665.4 PP

            GRAS 192 eeL..rvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseerik 284
                     ++L   v+++Ea+aVnl ++  + +  ++sl+     vL +vk+lsP++vv v++ +d+++ +F +++++ l+ ys l++sl+a    + ++ +k
  XP_009591500.1 580 WSLppLVSENEAIAVNLPVSSLSSY--QLSLPL----VLGFVKQLSPRIVVSVDKGCDRTDLPFPNHVIQVLQSYSNLLESLDAV-NVNFDALQK 667
                     555334788**********877776..555555....*********************************************665.3466999** PP

            GRAS 285 vErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +Er+ll+++i+  v+ + ++     e++++Wr+ + ++G++p+p+s++a++qa++++++++++g++ve+++ slvl+W++++L+s+SaWr
  XP_009591500.1 668 IERFLLQPRIERTVMGRFRS----PEKAQHWRALFLSSGLSPLPFSNFAESQAECVVKRTPVRGFHVEKRQSSLVLCWQRKELISASAWR 753
                     **************988777....9****************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098545.359365733IPR005202Transcription factor GRAS
PfamPF035141.5E-98392753IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0048768Biological Processroot hair cell tip growth
GO:0051301Biological Processcell division
Sequence ? help Back to Top
Protein Sequence    Length: 754 aa     Download sequence    Send to blast
MKGMPLPFDF EGKGVLDLDV VLNKNSIFNS WNYNSKESCY LVNSPSAVLD IIRSPRPVTS  60
SSTLSSSFGG GGGGGGTAST DTAGAVSANP SSKWQQQQQQ DNTTATSSNV GGAAAESELL  120
QVAAATEGKK CGMEEWEGGL SESVMASPCQ EQSILGWIMG DVDDTSMSNL NKVLQVSGPM  180
DYEFNAGFGV VDQGFGVDQI GTSSFMPAIN SSSVSSFPPT TTRMNSDKIG LLSNIPTHLP  240
QNPIFPSFSN NLGPVSFSQT QQQQPFESTD LKPQSFHSQF LIDQHQTQIP QNPSFLLPLP  300
FAQQEQNLVL PPKAKRHNPG TLEQPGSQIS QGLFIDAGEQ QPTPSHQLQL LPHFRPGGPI  360
GTKPKMVGEE MGQFHQLQLQ QQQQQQQQQA IIDQLFKAAE LVQTGNPVLA QGILARLNHQ  420
LSPIGKPFYR AAFYCKEALQ LLLHTNTNNL NNPSIPSSSP FSLIFKIGAY KSFSEISPVA  480
QFANFTCNQA LLEVLDGFER IHIVDFDIGY GRQWASLMQE LALRSGGAPT LKITALASPS  540
THDQLELGLT RESLIHFANE INMEFEFEIL SIDSLNSTSW SLPPLVSENE AIAVNLPVSS  600
LSSYQLSLPL VLGFVKQLSP RIVVSVDKGC DRTDLPFPNH VIQVLQSYSN LLESLDAVNV  660
NFDALQKIER FLLQPRIERT VMGRFRSPEK AQHWRALFLS SGLSPLPFSN FAESQAECVV  720
KRTPVRGFHV EKRQSSLVLC WQRKELISAS AWRC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A6e-363917534375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754400.0HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009591500.10.0PREDICTED: scarecrow-like protein 22
RefseqXP_016481267.10.0PREDICTED: scarecrow-like protein 22 isoform X1
TrEMBLA0A0V0IWJ20.0A0A0V0IWJ2_SOLCH; Putative scarecrow-like protein 22-like
STRINGSolyc01g090950.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA62532235
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00150.11e-123GRAS family protein