PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590822.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 544aa    MW: 60746.9 Da    PI: 6.5065
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590822.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS453.91e-1381745441374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l+++L++cA+a s+gdl  aq+l+++l++++s +g+p+qRl ay++e+L arla s+s++yk+ +++e +   s e l+++++++ev+P++kf++
  XP_009590822.1 174 LKHVLIACAKAESDGDLLTAQWLISELRQMVSVSGEPIQRLGAYILEGLVARLAASGSSIYKSQRCKEPA---SFELLSYMHILHEVCPYFKFGY 265
                     689******************************************************************9...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     + aN aI ea++ e+rvHiiDf+isqG QW++L+qa+a+Rp+gpp++RiTg+++++s   +   l+ +g+rL+ +Ae+++vpfef++ +a +++d
  XP_009590822.1 266 MSANGAIAEAMKDEQRVHIIDFQISQGSQWVTLIQAFAARPGGPPHIRITGIDDSKSAyaRGGGLNIVGKRLSTLAESFKVPFEFHA-AAISTSD 359
                     ******************************************************888899999************************.8999*** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     ++le+L ++pgEalaVn+++ lh+++desvs+e++rd++++lvksl+Pkvv++veqe+++n++ F+ rfle+l+yy+a+f+s++a+lpr+++eri
  XP_009590822.1 360 VQLENLGIRPGEALAVNFAFVLHHMPDESVSTENHRDRLIRLVKSLNPKVVTLVEQESNTNTAAFFPRFLETLDYYTAMFESIDATLPRAHKERI 454
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     +vE+++l+++ivn++aceg er+erhe l+kW++r+++aGF+p+pls+ +++++k+l++++ +  yr+ee++g+l+lgW++r Lv+ +aW+
  XP_009590822.1 455 NVEQHCLAKDIVNIIACEGIERVERHELLGKWKSRFRMAGFSPYPLSSLVNSTIKALVENYCD-KYRLEERDGALYLGWMNRDLVASCAWK 544
                     *************************************************************95.5*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.349148525IPR005202Transcription factor GRAS
PfamPF035143.6E-136174544IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 544 aa     Download sequence    Send to blast
MQASQRLRRS AMSDTLYKSV QKTEASYLPQ FQTLDKQMTN INRTQGGNHS IQTYSDWYCT  60
LESSSPTGKY AVQNSISAVS FTPNGSPISH QESQSCLSDV HYLPDTNYNS PVSGSCITDD  120
VNDFRHKLKE LETVMLGPNS DVLDSCDNSL PSCMTSPEIG CWRQMLEAIP RGDLKHVLIA  180
CAKAESDGDL LTAQWLISEL RQMVSVSGEP IQRLGAYILE GLVARLAASG SSIYKSQRCK  240
EPASFELLSY MHILHEVCPY FKFGYMSANG AIAEAMKDEQ RVHIIDFQIS QGSQWVTLIQ  300
AFAARPGGPP HIRITGIDDS KSAYARGGGL NIVGKRLSTL AESFKVPFEF HAAAISTSDV  360
QLENLGIRPG EALAVNFAFV LHHMPDESVS TENHRDRLIR LVKSLNPKVV TLVEQESNTN  420
TAAFFPRFLE TLDYYTAMFE SIDATLPRAH KERINVEQHC LAKDIVNIIA CEGIERVERH  480
ELLGKWKSRF RMAGFSPYPL SSLVNSTIKA LVENYCDKYR LEERDGALYL GWMNRDLVAS  540
CAWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-601785448375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590821.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009590822.10.0PREDICTED: scarecrow-like transcription factor PAT1
RefseqXP_009590823.10.0PREDICTED: scarecrow-like transcription factor PAT1
SwissprotQ9LDL70.0PAT1_ARATH; Scarecrow-like transcription factor PAT1
TrEMBLA0A0V0IJG70.0A0A0V0IJG7_SOLCH; Putative scarecrow-like transcription factor PAT1-like
STRINGSolyc07g047950.1.10.0(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G48150.20.0GRAS family protein