PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590536.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ARF
Protein Properties Length: 690aa    MW: 77175.1 Da    PI: 6.3961
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590536.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.31.2e-22130230198
                     EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                     f+k+lt sd++++g +++ +k+a+e+       ++ +++  +l+ +d++g +W++k+i+r++++r++lt+GW+ Fv +++L +gD +vF +   +
  XP_009590536.1 130 FCKILTASDTSTHGGFSVLRKHANEClplldmtQLTPTQ--DLVAKDLHGYEWRFKHIFRGQPRRHLLTTGWSTFVTSKRLVAGDAFVFLR--GD 220
                     99****************************988777766..7************************************************3..37 PP

                     EE..EEEEE- CS
              B3  89 efelvvkvfr 98 
                     ++ l+v+v+r
  XP_009590536.1 221 NGDLRVGVRR 230
                     7778**9998 PP

2Auxin_resp102.84.4e-34256335183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++t++ F v+Y+Pr+  s+F++ ++k+++a+++ +svGmRf+m+fe+eds+err++Gt+vgv d+++ +W++SkWrsLk
  XP_009590536.1 256 ASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERRFTGTIVGVGDISS-QWSESKWRSLK 335
                     789***************6..9**********************************************777.*********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-39122259IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.105.1E-39124245IPR015300DNA-binding pseudobarrel domain
CDDcd100177.82E-20128230No hitNo description
PfamPF023621.2E-20130230IPR003340B3 DNA binding domain
PROSITE profilePS5086311.843130232IPR003340B3 DNA binding domain
SMARTSM010193.0E-20130232IPR003340B3 DNA binding domain
PfamPF065076.7E-32256335IPR010525Auxin response factor
SuperFamilySSF542773.63E-13568651No hitNo description
PROSITE profilePS5174526.111575667IPR000270PB1 domain
PfamPF023092.5E-7621665IPR033389AUX/IAA domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 690 aa     Download sequence    Send to blast
MVQVEVFRGA PAVQSQNTGM ESDAMYTELW KACAGPLVDV PRTGERVYYF PQGHIEQLEA  60
STNQALKQQI PQFNLPSKIL CRVVHVQLLA ETETDEVYAQ ITLHPEAVQD EPSSPDPCPP  120
DLPKHAVHSF CKILTASDTS THGGFSVLRK HANECLPLLD MTQLTPTQDL VAKDLHGYEW  180
RFKHIFRGQP RRHLLTTGWS TFVTSKRLVA GDAFVFLRGD NGDLRVGVRR LARQQSHMPQ  240
SVISSQNMHL GVLATASHAI TTQTLFVVYY KPRTSQFIIG LNKYLEAVSH GFSVGMRFRM  300
RFEGEDSPER RFTGTIVGVG DISSQWSESK WRSLKIQWDE PASIVRPDRV SPWEIEPSVA  360
PTSIDVAQPG IKIKRPRPLE LPHTDISAAS AASPFWYPGS GPTLEVSHVG SIADNQLYWS  420
SEQNSSLSNG VSNTSCRTHL SEAWQHSMLA NGSLNMLRDS IEDNKQLTTR SALLDYGSPM  480
SSRASNGLLL DQVNRGNKHE ISSTCRLFGI DLRNNSNNTP TSEKDAPNIT SNYADGSEAD  540
KDQNVEHFNP SEEKKQVQLE ALLKDTHKQC LTSSRTRTKV QMQGVCVGRA VDLTGLSGYD  600
DLIIELEKIF DIKGELCPRN KWEVVYTDDE GDMMLVGDDP WLEFCKMVRR IFIYSSEEVK  660
KMSPRCKLPI LSLEGEGTMP SVDSELKSER
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1741935713354Auxin response factor 1
4ldw_A1e-1741935713354Auxin response factor 1
4ldw_B1e-1741935713354Auxin response factor 1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1373377KRPRP
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that bind specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). Could act as transcriptional activator or repressor. Formation of heterodimers with Aux/IAA proteins may alter their ability to modulate early auxin response genes expression. {ECO:0000269|PubMed:12036261}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754401e-110HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590536.10.0PREDICTED: auxin response factor 11 isoform X1
SwissprotQ9XED80.0ARFI_ARATH; Auxin response factor 9
TrEMBLA0A1S3Y3X90.0A0A1S3Y3X9_TOBAC; Auxin response factor
STRINGXP_009590536.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23472450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61830.10.0auxin response factor 18