PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009590520.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 493aa    MW: 55046.7 Da    PI: 4.3249
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009590520.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS351.41.4e-1071184801374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     lv+ L++c eav+ ++l+la+al+  ++e+a ++  p++++a+yf+eAL + +++   +l ++++ s  +     ++l+ ++  +e+ P+l+f++
  XP_009590520.1 118 LVKILMACGEAVQRNNLNLADALVRLIREHAVSQFGPIKKVATYFAEALDQWIHG--MNLEDIMEFSCYT-----DNLMQMR-SHEIRPYLEFAY 204
                     6789***************************************************..5555555555554.....2333332.369********* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledle 190
                      taN+aIl+a+++++rvHiiDf+++qG QW+aL+q +a Rp+gpp +R+Tg+gsp+++++++l++++++La+fA+ +gv+fef+ +v+++l+d++
  XP_009590520.1 205 STANRAILDAFANSSRVHIIDFSLNQGPQWLALMQDFALRPGGPPAFRLTGIGSPQPDNTNALRQLEWKLAEFADIFGVEFEFREIVVDSLADVD 299
                     *********************************************************************************************** PP

            GRAS 191 leeLrvkp..gEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsl..eaklpresee 281
                     +  L+++p   E +aVn++++l++ll  ++++e+    vL+ +k++ Pk+v+++e+ea++  + F++rf +a +yys++fdsl  ++++ ++++ 
  XP_009590520.1 300 IAILDIRPsnYEQVAVNSIFELQHLLYTPGEVEK----VLNSIKEMHPKIVTIIEEEANR--SVFMDRFNDAWSYYSKMFDSLenSESIDQHNSG 388
                     *******9999***************99999999....*******************987..9********************433456666688 PP

            GRAS 282 rikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkdrpLvsvSaWr 374
                     ++ + +e+lg++i n+vace     er etl++Wr ++++aGF+pv+l+ +++ qa ++l+ ++  dgyrve+++g+l+l W++rpL+s+S+W+
  XP_009590520.1 389 DSRLVHECLGQQINNMVACELGT--ERVETLSEWRVKMNSAGFNPVQLGPSTYLQATMILALFQnRDGYRVEQNDGCLTLSWHGRPLISTSVWQ 480
                     88888899************997..9*******************************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098551.20992459IPR005202Transcription factor GRAS
PfamPF035144.8E-105118480IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 493 aa     Download sequence    Send to blast
MSVGNLSMDT FREDGESFVS NTDAIINGTS DISGLTLSLI SDPNIPNSSN SSTSADDHLQ  60
QISTAAGGGG DMIVSGATSR IYNSIDFRAF SRNINAACDN YSDKVAEEGS ESMNEELLVK  120
ILMACGEAVQ RNNLNLADAL VRLIREHAVS QFGPIKKVAT YFAEALDQWI HGMNLEDIME  180
FSCYTDNLMQ MRSHEIRPYL EFAYSTANRA ILDAFANSSR VHIIDFSLNQ GPQWLALMQD  240
FALRPGGPPA FRLTGIGSPQ PDNTNALRQL EWKLAEFADI FGVEFEFREI VVDSLADVDI  300
AILDIRPSNY EQVAVNSIFE LQHLLYTPGE VEKVLNSIKE MHPKIVTIIE EEANRSVFMD  360
RFNDAWSYYS KMFDSLENSE SIDQHNSGDS RLVHECLGQQ INNMVACELG TERVETLSEW  420
RVKMNSAGFN PVQLGPSTYL QATMILALFQ NRDGYRVEQN DGCLTLSWHG RPLISTSVWQ  480
LNYAAESRLV SYV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A4e-501184804375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU0488710.0EU048871.1 Nicotiana tabacum isolate SSAP gp91tr retrotransposon Tnt1, flanking sequence and LTR.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009590520.10.0PREDICTED: DELLA protein GAI
SwissprotQ7Y1B61e-147GAI_SOLLC; DELLA protein GAI
TrEMBLK4D4701e-162K4D470_SOLLC; Uncharacterized protein
STRINGSolyc10g086380.1.11e-162(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA1696445
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G01570.11e-128GRAS family protein