PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Trihelix
Protein Properties Length: 296aa    MW: 34879.4 Da    PI: 8.1295
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588979.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix75.21.1e-2346128186
        trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                     +W+ qe+++ + +r e+++++ ++k++k lWe ++ km+++g +rsp+qCk+kw+nl +ryk +++ e +     ++++p++++l+
  XP_009588979.1  46 QWSIQETRDFLMIRAELDQTFMETKRNKLLWEVIATKMKDKGSNRSPEQCKCKWKNLVTRYKGCETLEPEA--L-RQQFPFYNELQ 128
                     7********************************************************************95..3.4589*****98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007170.007443105IPR001005SANT/Myb domain
CDDcd122035.48E-2345110No hitNo description
PfamPF138376.4E-1946130No hitNo description
PROSITE profilePS500907.4847103IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0042802Molecular Functionidentical protein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 296 aa     Download sequence    Send to blast
MDPHLHLHHH QHQHQHQNPF SHQSVNVDTS GGGVNIGTTS GDRFPQWSIQ ETRDFLMIRA  60
ELDQTFMETK RNKLLWEVIA TKMKDKGSNR SPEQCKCKWK NLVTRYKGCE TLEPEALRQQ  120
FPFYNELQAI FAARMQRMLW IEAEGGSGSK KKTISQLSSD EEEENEDSEG EKVVGITKKK  180
RKVKGNNVNI VGSSSSAGSG NLVNSFKEIL DDFMKQQMAM EMQWLKAYEA REEERRIKEM  240
EWRQTMEALE NERLMMERRW REREEQRRIR EEARAEKRDA LITALLNKLR REDHNM
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1177182KKKRKV
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that binds specifically to the core DNA sequence 5'-GTTAC-3'. {ECO:0000269|PubMed:15044016}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00481DAPTransfer from AT5G01380Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754481e-120HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755211e-120HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588979.10.0PREDICTED: trihelix transcription factor GT-3b-like
SwissprotQ9SDW02e-71TGT3A_ARATH; Trihelix transcription factor GT-3a
TrEMBLA0A1S3Y7860.0A0A1S3Y786_TOBAC; trihelix transcription factor GT-3b-like
STRINGXP_009588979.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G01380.13e-55Trihelix family protein