PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588814.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family bZIP
Protein Properties Length: 363aa    MW: 41157.1 Da    PI: 8.3155
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588814.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_134.73.8e-1179121345
                     XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaL 45 
                     ++k++rr+++NReAAr+sR RKka++++Le+   +L +  ++L
  XP_009588814.1  79 SDKVQRRLAQNREAARKSRMRKKAYVQQLETSRMKLAQLEMEL 121
                     68****************************9776666665544 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003389.3E-677137IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.11779123IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.4E-879125No hitNo description
PfamPF001706.0E-880121IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-781120No hitNo description
PROSITE patternPS0003608499IPR004827Basic-leucine zipper domain
PfamPF141443.3E-29168240IPR025422Transcription factor TGA like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MNMSSPSTQF APTTRMGIFE PFHHMSMWED AFRGEIMPGT GACMVAQPND RVDDKSGYTS  60
SEQLIPSGSE DNQAGKSVSD KVQRRLAQNR EAARKSRMRK KAYVQQLETS RMKLAQLEME  120
LERARQQGLY VLGSNGNMGL SATINPGIAA FEIEYGLWVE KQQKKNIELR NVLQSHVSEM  180
ELQLLVESVL SHYYNLFRIK ADAAKADVFY LMSGMWRTSV ERFFLWIGGF KPSELINVVM  240
PQLEPLSDQQ IVKICNLRHC CQQAEDALTQ GMDKLQQTLA QSILTMTTGM GSYSSQMVSS  300
MEKLEALESF VNQADHLRHQ TLQQMSHILT TRQTARGLLA FGEYLQRLRA LSSLWAARPR  360
EPT
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that binds specifically to the DNA sequence 5'-TGACG-3'. Recognizes ocs elements like the as-1 motif of the cauliflower mosaic virus 35S promoter. Binding to the as-1-like cis elements mediate auxin- and salicylic acid-inducible transcription. May be involved in the induction of the systemic acquired resistance (SAR) via its interaction with NPR1. Could also bind to the Hex-motif (5'-TGACGTGG-3') another cis-acting element found in plant histone promoters.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588814.10.0PREDICTED: transcription factor TGA1
RefseqXP_016476198.10.0PREDICTED: transcription factor TGA1-like
SwissprotQ392371e-153TGA1_ARATH; Transcription factor TGA1
TrEMBLA0A1S4AIE20.0A0A1S4AIE2_TOBAC; TGA7
STRINGXP_009588814.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7802497
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65210.51e-156bZIP family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Herrera-Vásquez A, et al.
    Transcriptional Control of Glutaredoxin GRXC9 Expression by a Salicylic Acid-Dependent and NPR1-Independent Pathway in Arabidopsis.
    Plant Mol. Biol. Rep., 2018.
    [PMID:26696694]
  4. Gutsche N,Zachgo S
    The N-Terminus of the Floral Arabidopsis TGA Transcription Factor PERIANTHIA Mediates Redox-Sensitive DNA-Binding.
    PLoS ONE, 2016. 11(4): p. e0153810
    [PMID:27128442]
  5. Sun T, et al.
    TGACG-BINDING FACTOR 1 (TGA1) and TGA4 regulate salicylic acid and pipecolic acid biosynthesis by modulating the expression of SYSTEMIC ACQUIRED RESISTANCE DEFICIENT 1 (SARD1) and CALMODULIN-BINDING PROTEIN 60g (CBP60g).
    New Phytol., 2018. 217(1): p. 344-354
    [PMID:28898429]