PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009587190.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 756aa    MW: 85617.1 Da    PI: 5.8987
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009587190.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS364.21.8e-1113837541374
            GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfsh 95 
                     l++l+++cA+av+++d + a +lL+++++++ p gd +qRla++f+ +L+arla+++s++ykal  ++ts    ++ l+a++l+   +P+ k+s 
  XP_009587190.1 383 LRTLMINCAQAVAADDSKSAYELLKQIRQHSYPFGDGNQRLAHCFADGLEARLAGTGSQIYKALVNKRTS---AADLLKAYHLYLASCPFRKISS 474
                     57899***********************************************************999998...9********************* PP

            GRAS  96 ltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvlvakrled 188
                     ++ N++I+  +++++rvH+iDf+i +G+QWp+++q +a+R++gpp+lRiTg++ p++g   +e++ee g+rLa++A++++vpfe+++ +ak++e+
  XP_009587190.1 475 FASNKTIMIKAKNATRVHVIDFGILYGFQWPTFIQRIAEREGGPPKLRITGIEFPQPGfrPAERIEESGRRLADYARSFNVPFEYHA-IAKKWET 568
                     *********************************************************9*****************************.7****** PP

            GRAS 189 leleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpreseeri 283
                     +++++L+++++E laV + ++ ++l+de+v  +s r+ vL l+++++P+++++   +  ++++ F++rf eal ++salfd+le+ +pre  er 
  XP_009587190.1 569 ITVDDLKLDKDEFLAVTCLYRFKNLYDETVVADSSRTVVLTLIRKINPDIFIHGIVNGAYSAPFFVTRFREALFHFSALFDMLETIVPREIPERG 663
                     *********************************************************************************************** PP

            GRAS 284 kvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                      +Ere++gre+ nv+aceg er+er et+++W+ r+  a F+++p++ + +++a   +r  + + + ++e+s +l+lgWk+r+++++S+W+
  XP_009587190.1 664 LIEREIFGREALNVIACEGWERVERPETYKQWQVRILGARFTQIPFEREFVNKAVEKVRLGYHRDFVIDEDSRWLLLGWKGRTIYAISCWK 754
                     ************************************************************99999*************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098564.233357734IPR005202Transcription factor GRAS
PfamPF035146.4E-109383754IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 756 aa     Download sequence    Send to blast
MDPRFNGNPS SLNDFRLGNQ SLPISSDGRM INGPRFELIY PDQKLHNGPR LENSFVQHNF  60
GGVGCINGDR LPSNLESRSD LGGVEEDFNE DIDFSDVVLS YINQMLMEEE MEDKTDMLQE  120
SLELQAKEKS FYEALGKKYP PSPEQNAFTN QYSESPDDYF SGSIYNSTSN TSENSGNLVD  180
SRGVNISTDY SSAYVESLSF RNTSVCSSNS GNTMVDGFLD SPVSSFHIPD IYNESQSIWS  240
FRKGVEEASK FLPTNNKLLN NDLPSRESKG EAGYVVGQVG EKDEVDTSPT EARGRKNPQR  300
DDNYNEEERS SKQAAIFTES TLRSEEFDIV LLHSMGKGEE ALEAYRQNLR NAKSKTTVQI  360
PKGSKGGKGR GKKQGGKKEV IDLRTLMINC AQAVAADDSK SAYELLKQIR QHSYPFGDGN  420
QRLAHCFADG LEARLAGTGS QIYKALVNKR TSAADLLKAY HLYLASCPFR KISSFASNKT  480
IMIKAKNATR VHVIDFGILY GFQWPTFIQR IAEREGGPPK LRITGIEFPQ PGFRPAERIE  540
ESGRRLADYA RSFNVPFEYH AIAKKWETIT VDDLKLDKDE FLAVTCLYRF KNLYDETVVA  600
DSSRTVVLTL IRKINPDIFI HGIVNGAYSA PFFVTRFREA LFHFSALFDM LETIVPREIP  660
ERGLIEREIF GREALNVIAC EGWERVERPE TYKQWQVRIL GARFTQIPFE REFVNKAVEK  720
VRLGYHRDFV IDEDSRWLLL GWKGRTIYAI SCWKPV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-453877548375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754480.0HG975448.1 Solanum pennellii chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009587190.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLM1AHK30.0M1AHK3_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000229960.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA27624191
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein