PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016513617.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 207aa    MW: 23479 Da    PI: 9.7745
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016513617.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF83.21.6e-26959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKA+ELS+LCda++ +i+fs tgkl+eyss
  XP_016513617.1  9 KKIDNLTARQVTFSKRRRGLFKKAQELSTLCDADIGLIVFSATGKLFEYSS 59
                    68***********************************************96 PP

2K-box401.6e-1483164990
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqee 90 
                     l++ + +s ++++  L +e  +  re+R+l Ge+L+ L l+eL++Le+ +e +++++ + K e ++++i+ l+kk+ +l+e 
  XP_016513617.1  83 LQSFNLQSEKKNYGILSREFAEKNRELRQLNGEELQGLGLEELMKLEKIVEGGISRVMKIKGEKFMREISSLKKKQARLNEV 164
                     677788999999999999999999****************************************************999875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006628.777161IPR002100Transcription factor, MADS-box
SMARTSM004327.7E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-26323IPR002100Transcription factor, MADS-box
CDDcd002651.88E-37378No hitNo description
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.49E-29376IPR002100Transcription factor, MADS-box
PfamPF003192.4E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-262338IPR002100Transcription factor, MADS-box
PRINTSPR004044.2E-263859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129710.0788176IPR002487Transcription factor, K-box
PfamPF014861.4E-1088163IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 207 aa     Download sequence    Send to blast
MVRQKIQIKK IDNLTARQVT FSKRRRGLFK KAQELSTLCD ADIGLIVFSA TGKLFEYSSS  60
SMMQLIDKHK VHSDRDMDSP DQLQSFNLQS EKKNYGILSR EFAEKNRELR QLNGEELQGL  120
GLEELMKLEK IVEGGISRVM KIKGEKFMRE ISSLKKKQAR LNEVEGHNAI EGGHSADSIT  180
TNHSLVNGHL DYIDSVTSLK LGLPIPY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-17174174Myocyte-specific enhancer factor 2B
1tqe_Q2e-17174174Myocyte-specific enhancer factor 2B
1tqe_R2e-17174174Myocyte-specific enhancer factor 2B
1tqe_S2e-17174174Myocyte-specific enhancer factor 2B
3mu6_A1e-17372271Myocyte-specific enhancer factor 2A
3mu6_B1e-17372271Myocyte-specific enhancer factor 2A
3mu6_C1e-17372271Myocyte-specific enhancer factor 2A
3mu6_D1e-17372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY6437271e-173AY643727.1 Physalis pubescens MPF1 (MPF1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016513617.11e-150PREDICTED: MADS-box protein JOINTLESS-like isoform X3
SwissprotQ9FVC12e-60SVP_ARATH; MADS-box protein SVP
TrEMBLQ537H31e-117Q537H3_9SOLA; MPF1
STRINGPGSC0003DMT4000837391e-112(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.11e-48MIKC_MADS family protein