PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016513125.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 286aa    MW: 32858.9 Da    PI: 5.8717
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016513125.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM159.71.2e-49101381129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                     lppGfrF P+deelv++yL kk+++++     ++ e+d++++ePw+Lp+ +k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd++vl+ 
  XP_016513125.1  10 LPPGFRFYPSDEELVCHYLFKKIANEEALK-GTLVEIDLHTCEPWQLPEVAKLNSSEWYFFSFRDRKYATGFRTNRATTSGYWKATGKDRTVLDP 103
                     79***********************99544.78***************87788899**************************************9 PP

             NAM  96 .kgelvglkktLvfykgrapkgektdWvmheyrle 129
                      ++++vg++ktLvfyk+rap+g k+ W+mhe+rle
  XP_016513125.1 104 rTRTTVGMRKTLVFYKNRAPNGIKSGWIMHEFRLE 138
                     66778***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.36E-608156IPR003441NAC domain
PROSITE profilePS5100557.40610156IPR003441NAC domain
PfamPF023653.1E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 286 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELVCHYLFK KIANEEALKG TLVEIDLHTC EPWQLPEVAK  60
LNSSEWYFFS FRDRKYATGF RTNRATTSGY WKATGKDRTV LDPRTRTTVG MRKTLVFYKN  120
RAPNGIKSGW IMHEFRLENP HIPPKEDWVL CRVFHKAKAE NSSNNILSPQ NMYEVGVVSS  180
PNNNMDQYHA LPFGGYRPNM AATAVSQRPL HQSQKLFDLM EPESNQSSYT RLPQEMNKAP  240
SNDQIAEDEY GFLLDMNFED PSLQDEGVHS SIEDLTFDND NSLVFI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A6e-471015615168Stress-induced transcription factor NAC1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269|PubMed:11114891}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Induced by auxin.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754482e-62HG975448.1 Solanum pennellii chromosome ch09, complete genome.
GenBankHG9755212e-62HG975521.1 Solanum lycopersicum chromosome ch09, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016513125.10.0PREDICTED: NAC domain-containing protein 21/22-like
SwissprotQ84TE63e-63NAC22_ARATH; NAC domain-containing protein 21/22
TrEMBLA0A1S4DI980.0A0A1S4DI98_TOBAC; NAC domain-containing protein 21/22-like
STRINGXP_009607926.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.12e-94NAC domain containing protein 74
Publications ? help Back to Top
  1. Le Hénanff G, et al.
    Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance.
    J. Exp. Bot., 2013. 64(16): p. 4877-93
    [PMID:24043850]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Xiao D, et al.
    SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis.
    Plant Physiol., 2015. 169(2): p. 1275-91
    [PMID:26304848]
  4. Huo X,Wang C,Teng Y,Liu X
    Identification of miRNAs associated with dark-induced senescence in Arabidopsis.
    BMC Plant Biol., 2015. 15: p. 266
    [PMID:26530097]
  5. Chen X, et al.
    Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis.
    Plant Physiol., 2016. 170(4): p. 2136-45
    [PMID:26850273]
  6. Liu C,Wang B,Li Z,Peng Z,Zhang J
    TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth.
    Plant Physiol., 2018. 176(1): p. 742-756
    [PMID:29122985]