PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016512846.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 1001aa    MW: 111310 Da    PI: 7.6794
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016512846.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP125.32.4e-39151228178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C++dls+ak+yhrrhkvC+vhska+++lv +++qrfCqqCsrfh l+efDe+krsCrrrLa+hn+rrrk+++
  XP_016512846.1 151 CCQVQDCRTDLSNAKDYHRRHKVCDVHSKAAKALVGNVMQRFCQQCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHP 228
                     6**************************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-30147213IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.872149226IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.29E-36150231IPR004333Transcription factor, SBP-box
PfamPF031102.1E-28152225IPR004333Transcription factor, SBP-box
SuperFamilySSF484036.06E-7771880IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.203.8E-6773880IPR020683Ankyrin repeat-containing domain
CDDcd002043.03E-7774881No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1001 aa     Download sequence    Send to blast
MAAHNYHGPV SGKKSMEWDL NDWKWDGDLF TAAPLNNNSV PSDCCKSKQL MFPIGSDIHP  60
ETSRISNCFP SGSDELLTLG NNDKRRKELE KRRRAIVIED DELDNEEEAG SLNLKLGGQL  120
YPVMEGDVEK WEGKSGKKTK IGGVLSNRAV CCQVQDCRTD LSNAKDYHRR HKVCDVHSKA  180
AKALVGNVMQ RFCQQCSRFH VLQEFDEGKR SCRRRLAGHN RRRRKTHPEN VANGASMNDE  240
GGSNYLLISL LRILANVQSN SSDQTKDQDL LSHLLRNLAS LVGATNERNT WGLLSAPPEQ  300
RNAGTSMGAP KEESLRPTGN CLIPASEVTE KRMGRSDVEC GILQNPCAWQ PDSLCCRKES  360
SPINANASAK VKLNNIDLNN IYDDSQDGNQ KLQNSDASAN PGASSSGCPL WICHDPHKSS  420
PGTSGNSGST SSLSLSNSSG EAQSRTDRIV FKLFGKDPGD FPTALRKEIL DWLSHSPTDI  480
ESYIRPGCII LTIYLRMDKS IWEELYCDLN SSLRKLLNAS ADSFWQTGWV YTRVNDRVAF  540
LFNGQVVLDT SLPVKRHRSC GISIVKPIAV CASKRVQFLV KGFNLSRPTT RLLCALEGNY  600
LVQGNCTDMM VGADSCLDHE EIQSLSFPCI VPNVTGRGFI EVEDHGLSSN FFPFIVAEKD  660
VCSEIRTLES NIEVDEMADG FLQGTEKLQA RDQALEFLHE MGWLLHRSHL KFRVGSGVNL  720
NLFPFQRFKW LIEFSIDQDW CAVVKKLLDV FFNGVVDVGQ QSSLDVPLRE VGILHQAVRR  780
KCKSMVEVLL KYRPHGAFDK SGLKKQQDDR DYLFRPDAVG PGGLTPLHIV ASLAGFENLL  840
DALIDDPGQV GIEAWKSACD STGLTPNDYA CLRGHYSYIH IVQKKIGQKP GDEHVVLDIP  900
GSVLDSSIKQ KLSNGHRSVS IASLQTEKSL RKPIKTHCRQ CDQKYYYGNP GSSLAIYKPA  960
MLSMVAIAAI CVCVALLFKS SPEVLYSFRP FRWELLKYGS I
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-281522251184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754440.0HG975444.1 Solanum pennellii chromosome ch05, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016512846.10.0PREDICTED: squamosa promoter-binding-like protein 12
TrEMBLA0A1S4DHL50.0A0A1S4DHL5_TOBAC; squamosa promoter-binding-like protein 12
STRINGXP_009617582.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1