PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016512460.1
Common NameGLO
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 209aa    MW: 24691.2 Da    PI: 9.4443
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016512460.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF95.81.9e-30959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krien+snrqvt+skRrngilKKA+E+SvLCda+v+viif+s+gk++e+ss
  XP_016512460.1  9 KRIENSSNRQVTYSKRRNGILKKAKEISVLCDARVSVIIFASSGKMHEFSS 59
                    79***********************************************96 PP

2K-box87.82.1e-2969164196
           K-box   1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLr 95 
                     y+k +g++l++ak+e+l++e++k+kk ++n+q e+Rhl+Ged++sL+++eL+ Le++L+++l++iR+k+n+ll+++ +++q +e+e+++ n +Lr
  XP_016512460.1  69 YHKLTGRRLWDAKHENLDNEINKVKKDNDNMQIELRHLKGEDITSLNHRELMMLEDALDNGLTSIRNKQNDLLRMMRKKTQSMEEEQDQLNWQLR 163
                     78999999**************************************************************************************9 PP

           K-box  96 k 96 
                     +
  XP_016512460.1 164 Q 164
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004322.0E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006632.31161IPR002100Transcription factor, MADS-box
CDDcd002656.04E-42278No hitNo description
SuperFamilySSF554554.97E-36294IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-231057IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.2E-283859IPR002100Transcription factor, MADS-box
PfamPF014868.2E-1780161IPR002487Transcription factor, K-box
PROSITE profilePS5129713.71182173IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0007275Biological Processmulticellular organism development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MGRGKIEIKR IENSSNRQVT YSKRRNGILK KAKEISVLCD ARVSVIIFAS SGKMHEFSST  60
SLVDILDQYH KLTGRRLWDA KHENLDNEIN KVKKDNDNMQ IELRHLKGED ITSLNHRELM  120
MLEDALDNGL TSIRNKQNDL LRMMRKKTQS MEEEQDQLNW QLRQLEIASM NRNMGEIGEV  180
FHQRENEYQT QMPFAFRVQP MQPNLQERF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-17269168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in the genetic control of flower development. Acts in conjunction with DEFICIENS (defA).
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankX679590.0X67959.1 N.tabacum GLO mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016512460.11e-154PREDICTED: floral homeotic protein GLOBOSA
SwissprotQ034161e-156GLOB_TOBAC; Floral homeotic protein GLOBOSA
TrEMBLW8YE801e-149W8YE80_TOBAC; Type II (MIKC) MADS-box transcription factor (Fragment)
STRINGSolyc08g067230.2.11e-134(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46802139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G20240.19e-78MIKC_MADS family protein
Publications ? help Back to Top
  1. Hansen G,Estruch JJ,Sommer H,Spena A
    NTGLO: a tobacco homologue of the GLOBOSA floral homeotic gene of Antirrhinum majus: cDNA sequence and expression pattern.
    Mol. Gen. Genet., 1993. 239(1-2): p. 310-2
    [PMID:8099711]