PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016511592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 221aa    MW: 25317 Da    PI: 7.3011
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016511592.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF92.22.5e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdaev +iifs++gklye++s
  XP_016511592.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLIIFSPRGKLYEFAS 59
                    8***********************************************86 PP

2K-box78.51.7e-2683172998
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     +e++++++l++e + L k+ie L++++R+llGe+L+s+sl+e+qq+e+qLe+sl+ iR++K+e+++eqi +l++  k+l++en +L +k 
  XP_016511592.1  83 VEQNNMQNLKHETTTLMKKIELLETSKRKLLGEGLGSCSLEEIQQIERQLERSLNVIRARKMEVFREQIGRLKENVKDLSSENAMLLEKC 172
                     8899**********************************************************************************9985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.511161IPR002100Transcription factor, MADS-box
SMARTSM004321.0E-40160IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.09E-32374IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002659.02E-44375No hitNo description
PfamPF003191.5E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.5E-2684172IPR002487Transcription factor, K-box
PROSITE profilePS5129714.84888178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 221 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLIIFSP RGKLYEFASS  60
SMQEIMERYR KHNEDVRGEI PPVEQNNMQN LKHETTTLMK KIELLETSKR KLLGEGLGSC  120
SLEEIQQIER QLERSLNVIR ARKMEVFREQ IGRLKENVKD LSSENAMLLE KCGDLEQPKA  180
SSGEDQGEDL SLSVEGSEKS DVETELFIGL PECRTKRPLQ N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D5e-21374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C5e-21374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B5e-21374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A5e-21374273MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J5e-21374273Myocyte-specific enhancer factor 2A
3p57_I5e-21374273Myocyte-specific enhancer factor 2A
3p57_D5e-21374273Myocyte-specific enhancer factor 2A
3p57_C5e-21374273Myocyte-specific enhancer factor 2A
3p57_B5e-21374273Myocyte-specific enhancer factor 2A
3p57_A5e-21374273Myocyte-specific enhancer factor 2A
3kov_J5e-21374273Myocyte-specific enhancer factor 2A
3kov_I5e-21374273Myocyte-specific enhancer factor 2A
3kov_B5e-21374273Myocyte-specific enhancer factor 2A
3kov_A5e-21374273Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009782122.11e-159PREDICTED: MADS-box protein SOC1-like
RefseqXP_016511592.11e-159PREDICTED: MADS-box protein SOC1-like
SwissprotO646452e-85SOC1_ARATH; MADS-box protein SOC1
TrEMBLQ9ATE31e-127Q9ATE3_PETHY; MADS-box transcription factor FBP28
STRINGPGSC0003DMT4000265761e-114(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.19e-67AGAMOUS-like 20