PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016511352.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 644aa    MW: 71715 Da    PI: 8.8921
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016511352.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.92e-093934301954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LAk++gLt +qV++WF N R +
  XP_016511352.1 393 FEHflHPYPKDSDKIMLAKQTGLTRSQVSNWFINARVR 430
                     554459******************************88 PP

2BELL119.71.3e-38256327172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +rqe q+kkakL+++leeV++rY+qy++q+q+++ssFe+vag+gsak+Yt+lAl+aiS++FrcLkdai++qi
  XP_016511352.1 256 QRQEFQMKKAKLVTMLEEVEQRYRQYHHQMQIIVSSFEQVAGIGSAKSYTQLALHAISKQFRCLKDAIVGQI 327
                     699********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.7E-60180325IPR006563POX domain
PfamPF075264.7E-48185324IPR006563POX domain
PROSITE profilePS5007112.05371434IPR001356Homeobox domain
SMARTSM003894.2E-10374438IPR001356Homeobox domain
CDDcd000861.44E-11374435No hitNo description
SuperFamilySSF466894.71E-17375441IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.4E-29377440IPR009057Homeodomain-like
PfamPF059202.5E-18391430IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 644 aa     Download sequence    Send to blast
MYYQGTSDNI HQAADGNIQT LYLMNPNYIH QGYTDTQQQH QHQQQIMSHA PLQQAQQHFV  60
GVPLPAVSLH DQNHAQLIHR LWNQSGGGGG SGNGSHHQSQ IIPSSTVVSA TSCGGTTTDL  120
ASQLGFQRSI TMSPTQQQQQ QQQQQRGGLS LSLSPQQQQI RFNNISAQNQ VGSNINRGLD  180
GISSMVLGSK YLKAAQELLD EVVNVGKCIK GSELDKEEFI NKESILPLAS DVNTTNSGGE  240
SSSKKKNGVA ELTTAQRQEF QMKKAKLVTM LEEVEQRYRQ YHHQMQIIVS SFEQVAGIGS  300
AKSYTQLALH AISKQFRCLK DAIVGQIKAT SKSLGEEDQS LGGKIEGSRL KFVDHHLRQQ  360
RALQQLGMMQ PNAWRPQRGL PERAVSVLRA WLFEHFLHPY PKDSDKIMLA KQTGLTRSQV  420
SNWFINARVR LWKPMVEEMY LEEVKNNQEQ NTSSEENKNK NELNKEKVVS KSSAPQENGT  480
PTEISTSTIS TSPTAGGSFQ AVQAHNFSFI GSLNMENNTT AKKPRNHDMY NSSPSSILSS  540
VDMAETKARN HQSNKRFNPL MDATAAYTMG EFGRFNPHEQ MAATNFHGNN GVSLTLGLPP  600
NSENLSQQNY QIEFNRMSYE NIDFQNKRFP SQLLPDFVAG NLGT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16380438563Homeobox protein Meis2
3k2a_B3e-16380438563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016511352.10.0PREDICTED: BEL1-like homeodomain protein 1
TrEMBLQ7Y0Z70.0Q7Y0Z7_SOLLC; Bell-like homeodomain protein 2
STRINGSolyc06g074120.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14782467
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G35940.31e-103BEL1-like homeodomain 1