PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510731.1
Common NameNtabSPL6-7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 434aa    MW: 49583.6 Da    PI: 7.7566
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510731.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.92.1e-41126201277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv gC++dls+ k+yh+rhkvC+ hsk ++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  XP_016510731.1 126 CQVYGCNKDLSSSKDYHKRHKVCDEHSKFAKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQ 201
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.108.9E-34120187IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394123200IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-39124205IPR004333Transcription factor, SBP-box
PfamPF031108.1E-32126199IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MLSTSVITLD PILGEVELEE RFNHMAKRSN DPISLPIGLK LEQSIEHGEV RSSQSSNGIS  60
VLPTEKDYSH SPICQVRDHR KEETIVYREV KSNSSLMENS ALSSLEPLLL GKRSRTTNVH  120
SQVPLCQVYG CNKDLSSSKD YHKRHKVCDE HSKFAKVIVN GIEQRFCQQC SRFHLLAEFD  180
EGKRSCRKRL AGHNERRRKP QFDTHWDSRL LDMTSQRRAP FLFPEIRLGS SFCQERFEDH  240
SKHIKMEEKP ICISQLAMAV TKKQSPSKSL QHHHGTRKEN SSKIHLGATL SVEELSSGQN  300
SACALSLLSA HSQHHLHNLE NYCAHLKRDH NPEDFCELSA SRSFSSNELY SCEVIGTDRI  360
VQVLDDSQAV STDDLRERRV RRSYSMNSKN DLSPEDGPTV DLVQLSSHLQ RVEQLKHSDQ  420
AKQENDIFRC FTTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-28121199684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732950.0LC073295.1 Nicotiana tabacum NtabSPL6-7 mRNA for squamosa promoter binding protein NtabSPL6-7, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313122.10.0squamosa promoter-binding-like protein 6
RefseqXP_016510730.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_016510731.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X2
TrEMBLA0A125SZN40.0A0A125SZN4_TOBAC; Squamosa promoter binding protein NtabSPL6-7
TrEMBLA0A1S4DBE60.0A0A1S4DBE6_TOBAC; squamosa promoter-binding-like protein 6 isoform X2
STRINGXP_009600444.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-47SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]