PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016510730.1
Common NameNtabSPL6-7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 524aa    MW: 59464.8 Da    PI: 7.2452
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016510730.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP131.52.8e-41216291277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv gC++dls+ k+yh+rhkvC+ hsk ++v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  XP_016510730.1 216 CQVYGCNKDLSSSKDYHKRHKVCDEHSKFAKVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQ 291
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-33210277IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.394213290IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.37E-39214295IPR004333Transcription factor, SBP-box
PfamPF031101.1E-31216289IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 524 aa     Download sequence    Send to blast
MDYALEGRGI LFPDNIEMPV GALAKRNIVK DWNLKNPFSN VDRSIFGTIQ EITVNTDFPE  60
SGIVDILEKC ASSKQWLGGL GAETVDASRN MLSTSVITLD PILGEVELEE RFNHMAKRSN  120
DPISLPIGLK LEQSIEHGEV RSSQSSNGIS VLPTEKDYSH SPICQVRDHR KEETIVYREV  180
KSNSSLMENS ALSSLEPLLL GKRSRTTNVH SQVPLCQVYG CNKDLSSSKD YHKRHKVCDE  240
HSKFAKVIVN GIEQRFCQQC SRFHLLAEFD EGKRSCRKRL AGHNERRRKP QFDTHWDSRL  300
LDMTSQRRAP FLFPEIRLGS SFCQERFEDH SKHIKMEEKP ICISQLAMAV TKKQSPSKSL  360
QHHHGTRKEN SSKIHLGATL SVEELSSGQN SACALSLLSA HSQHHLHNLE NYCAHLKRDH  420
NPEDFCELSA SRSFSSNELY SCEVIGTDRI VQVLDDSQAV STDDLRERRV RRSYSMNSKN  480
DLSPEDGPTV DLVQLSSHLQ RVEQLKHSDQ AKQENDIFRC FTTT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-28211289684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732950.0LC073295.1 Nicotiana tabacum NtabSPL6-7 mRNA for squamosa promoter binding protein NtabSPL6-7, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001313122.10.0squamosa promoter-binding-like protein 6
RefseqXP_016510730.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A125SZN40.0A0A125SZN4_TOBAC; Squamosa promoter binding protein NtabSPL6-7
STRINGXP_009600444.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.16e-47SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]