PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016509518.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 204aa    MW: 22321.4 Da    PI: 6.876
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016509518.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.15.4e-42411401100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf  +h++FGasn++k+l++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+++la
  XP_016509518.1  41 PCAACKILRRRCAEKCVLAPYFPPNDPIKFTTAHRVFGASNIIKFLQELPEFQRADAVSSMVYEANARLRDPVYGCAGAICHLQKQVNELQVQLA 135
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016509518.1 136 KAQAE 140
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.8540141IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4241138IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 204 aa     Download sequence    Send to blast
MESSDTTVTT ITSPISSRSV SPSSASPRNS PPPPQVAIVS PCAACKILRR RCAEKCVLAP  60
YFPPNDPIKF TTAHRVFGAS NIIKFLQELP EFQRADAVSS MVYEANARLR DPVYGCAGAI  120
CHLQKQVNEL QVQLAKAQAE IVNMQCEQAN LMALICMEMT QSPQASPQHY SLGHLTNITY  180
GSSQSNMTFL DDNSFGSFSE TLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-434014810118LOB family transfactor Ramosa2.1
5ly0_B7e-434014810118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754453e-48HG975445.1 Solanum pennellii chromosome ch06, complete genome.
GenBankHG9755183e-48HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009610820.11e-152PREDICTED: LOB domain-containing protein 1-like
RefseqXP_016509518.11e-152PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR07e-69LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A1S4D8501e-150A0A1S4D850_TOBAC; LOB domain-containing protein 1-like
STRINGXP_009610820.11e-151(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-70LOB domain-containing protein 1