PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016509383.1
Common NameNtabSPL6-2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 494aa    MW: 54461 Da    PI: 8.2809
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016509383.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP133.66.3e-42173249278
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     Cqv+gC++dls+ k+y++rhkvCevhsk+++v+v+g+eqrfCqqCsrfh l efD++krsCr+rLa+hnerrrk+q+
  XP_016509383.1 173 CQVQGCSKDLSSSKDYNKRHKVCEVHSKTAKVIVNGIEQRFCQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRKPQT 249
                     **************************************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.0E-33168234IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.334170247IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.15E-39171250IPR004333Transcription factor, SBP-box
PfamPF031106.0E-32173246IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 494 aa     Download sequence    Send to blast
MYCRKKTSQF LKQKMESWSF FSVGKGFVSE DSVSLDDRII REKHCVTSWE LNNPSSFGST  60
VGIENQEFPK LGTPNNQIRD VLSNKISGGG VFSSVTVPQI VFSGASESSS KMSRSVVESN  120
CRDSSLVDLK LGSFPGQQHV QSFKSPKIMT NLSSNVPDKR MRSGGLKYQT PYCQVQGCSK  180
DLSSSKDYNK RHKVCEVHSK TAKVIVNGIE QRFCQQCSRF HLLAEFDDGK RSCRKRLAGH  240
NERRRKPQTG STGRFQGTSF AMSSSLCQNI LGSSILYQPK YEMEDWYKNV KVEDAADYNP  300
RLTMPFTNGH SQSKSLCTSY HAEKQCPPFH DEEITAPTRS KIDESSKSYL HDIEGSDFVT  360
RPLVQSFSIG GDVLHVLDSI STIQGISGIS NSGCAPSLLS SQSQDSSNQS SLIPTASHLI  420
TPSSNAHYNV THISEKPLGV SPQALSSRVP DTFNSAGVNS GESCLEQILV SNSSNNCFIN  480
DPMIDLLQLS SQIQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-291732461184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0733030.0LC073303.1 Nicotiana tabacum NtabSPL6-2 mRNA for squamosa promoter binding protein NtabSPL6-2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009777325.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
RefseqXP_009777331.10.0PREDICTED: squamosa promoter-binding-like protein 6 isoform X1
TrEMBLA0A1S4D7R50.0A0A1S4D7R5_TOBAC; squamosa promoter-binding-like protein 6
TrEMBLA0A1U7WJ850.0A0A1U7WJ85_NICSY; squamosa promoter-binding-like protein 6 isoform X1
STRINGXP_009777325.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51871639
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.13e-45SBP family protein
Publications ? help Back to Top
  1. Han YY,Ma YQ,Li DZ,Yao JW,Xu ZQ
    Characterization and phylogenetic analysis of fifteen NtabSPL genes in Nicotiana tabacum L. cv. Qinyan95.
    Dev. Genes Evol., 2016. 226(1): p. 1-14
    [PMID:26635304]