PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507693.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 967aa    MW: 108612 Da    PI: 6.51
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507693.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.84.7e-41111188178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +Cqv++C +dls+ak+yhrrhkvCe+hsk++ +lvs+l+qrfCqqCsrfh+l+efDe+krsCrrrLa+hn+rrrk+qa
  XP_016507693.1 111 MCQVDDCGVDLSNAKDYHRRHKVCEMHSKSSRALVSNLMQRFCQQCSRFHALEEFDEGKRSCRRRLAGHNKRRRKTQA 188
                     6**************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.6E-33106173IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.214109186IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.32E-38110190IPR004333Transcription factor, SBP-box
PfamPF031108.0E-30112185IPR004333Transcription factor, SBP-box
SuperFamilySSF484033.73E-7684855IPR020683Ankyrin repeat-containing domain
Gene3DG3DSA:1.25.40.201.9E-4743855IPR020683Ankyrin repeat-containing domain
CDDcd002041.91E-6745855No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 967 aa     Download sequence    Send to blast
MEARMGGETQ LFKKSLEWDP NDWKWDGDLF IARPKIPSSN YQFFPLETGN SSSSCSDEVN  60
HGEFEKRRRR ETDENVEYDS ASLSLKLGEQ RAHPREFGKR TKLNTTSSRA MCQVDDCGVD  120
LSNAKDYHRR HKVCEMHSKS SRALVSNLMQ RFCQQCSRFH ALEEFDEGKR SCRRRLAGHN  180
KRRRKTQADS GDNNKTLNDV QASGYSLMSL LKILSNIHSN RTNHIEDQNL LSHLLRSLAS  240
QGIPYGDNNL SGLLQASSNL LNNRSPSRNS DIVSLVSNGS RRPPIPKEQH FATTLAAQVP  300
QISSDVHDVR LEDVQTESYQ SPGTSFPIQN SSPAYAQARE SSAGRRNLIN FDLNDVYDGS  360
DDSRENLDRS PLPADRGIGP LECRSWLQQD SQQSSPPSRN SDSASTQSPS SSSSDAQSRT  420
DRIVFKLFGK DPTDFPYVLR AQILDWLSHS PSEIESYIRP GCIVLTVYLR LPESAWEELC  480
CDLSSTLSRL LDVPGNSFWR KGWIYIRVQN QIAFVHDGKL LLDVPLPFET IEHTSILSVK  540
PIAVPVSDRA QFIVKGYNLT KPSTRLLCAL EGNYLVIEAN DEVEHVDGVK KHAELQSINL  600
TCSIPAVSGR GFIEVEDHGL SNGFFPIIIA EEDVCSEICM LESAIELTPA DYVNGLTNNV  660
EVKSQAMDFI HEMGWLLHRN NLKARLGNSN AVLFPLKRFK WLMEFSIDHG WCAVVRKLLN  720
LLLDGTVGGE ENSFLKVSLS EMGLLHKAVR RNSRPLVELL LTYTPEEVAD ELCSEYQSLV  780
GVNGKFLFRP DSVGPAGLTP LHVAAGIDGY EDVLDSLTDD PGMVAIEAWK NKRDSAGFTP  840
EDYARLRGHY SYIHLVQRKI NRVTAKHIVV DIPNNLSDGN SNQKDECATA SFEVSQTERR  900
LIQPCGMCDR KLVYGRQSRS LLYRPVMFSM VALAAVCVCV ALLFKSSPEV LYIFRPFRWE  960
MLDYGSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-311111851084squamosa promoter binding protein-like 4
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Binds specifically to the 5'-GTAC-3' core sequence. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16095614}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773067.10.0PREDICTED: squamosa promoter-binding-like protein 1
RefseqXP_016507693.10.0PREDICTED: squamosa promoter-binding-like protein 1
SwissprotQ9SMX90.0SPL1_ARATH; Squamosa promoter-binding-like protein 1
TrEMBLA0A1S4D2Y70.0A0A1S4D2Y7_TOBAC; squamosa promoter-binding-like protein 1
TrEMBLA0A1U7VZ740.0A0A1U7VZ74_NICSY; squamosa promoter-binding-like protein 1
STRINGXP_009773067.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18712466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G47070.10.0squamosa promoter binding protein-like 1
Publications ? help Back to Top
  1. Jorgensen SA,Preston JC
    Differential SPL gene expression patterns reveal candidate genes underlying flowering time and architectural differences in Mimulus and Arabidopsis.
    Mol. Phylogenet. Evol., 2014. 73: p. 129-39
    [PMID:24508602]
  2. Chao LM, et al.
    Arabidopsis Transcription Factors SPL1 and SPL12 Confer Plant Thermotolerance at Reproductive Stage.
    Mol Plant, 2017. 10(5): p. 735-748
    [PMID:28400323]