PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 28070.8 Da    PI: 9.8822
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507613.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.71.5e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+EL +LCdaev viifsstg+lyeyss
  XP_016507613.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGVIIFSSTGRLYEYSS 59
                    8***********************************************96 PP

2K-box13.82.4e-0681108936
           K-box   9 leeakaeslqqelakLkkeienLqreqR 36 
                     + +++   +q+e+a L+++++nLq+++R
  XP_016507613.1  81 TPTSEVRFWQREAAMLRQQLQNLQENHR 108
                     5678899*******************99 PP

3K-box67.54.4e-231271913498
           K-box  34 eqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                      +R+++Ge+L+ Ls+k+Lq+Le+qLe sl+ +R +K+e+l+++i+el +k + +++en++L kk+
  XP_016507613.1 127 DIRQMMGEQLSGLSVKDLQNLENQLEMSLRGVRVRKDEILIDEIQELNRKGNLIHQENMELYKKV 191
                     68***********************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004328.8E-40160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.819161IPR002100Transcription factor, MADS-box
CDDcd002652.65E-46278No hitNo description
SuperFamilySSF554556.8E-33291IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004042.5E-283859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129713.90386197IPR002487Transcription factor, K-box
PfamPF014862.9E-21127191IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGVIIFSS TGRLYEYSST  60
SMKSVIERYN KTKEENHQLA TPTSEVRFWQ REAAMLRQQL QNLQENHRLR APRLIPRNTY  120
HLPPATDIRQ MMGEQLSGLS VKDLQNLENQ LEMSLRGVRV RKDEILIDEI QELNRKGNLI  180
HQENMELYKK VYGNRDANGV SGNSLAPNSL SINEDPHAPV HLQLSQPQQQ NYDTSGTTEL  240
GLQLH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P2e-20174174Myocyte-specific enhancer factor 2B
1tqe_Q2e-20174174Myocyte-specific enhancer factor 2B
1tqe_R2e-20174174Myocyte-specific enhancer factor 2B
1tqe_S2e-20174174Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755164e-51HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankHG9754434e-51HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507613.10.0PREDICTED: MADS-box transcription factor 23-like isoform X3
SwissprotQ6EP491e-100MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLX5DS451e-126X5DS45_COFAR; AGL16
STRINGVIT_18s0001g07900.t011e-118(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57230.15e-96AGAMOUS-like 16