PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 235aa    MW: 27131.9 Da    PI: 9.5446
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507439.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF89.32e-281059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    ri+n++ rqvtfskRrng+lKKA+EL +LCdaev +iifsstgklye+s+
  XP_016507439.1 10 RIDNSTSRQVTFSKRRNGLLKKAKELAILCDAEVGLIIFSSTGKLYEFSN 59
                    8***********************************************95 PP

2K-box76.19.1e-2680170898
           K-box   8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     ++  ++ + +qqe++ L+++++ Lq+++R+l+Ge+L  L +k+L +Le+qLe sl+ iR  K+++l+++i+el +k  ++++en +L kk+
  XP_016507439.1  80 HNPVSELKLWQQEAEILRQQLQDLQENHRQLMGEELCGLGVKDLTNLENQLEISLRGIRMEKEQILKDEIQELTQKGSMIHQENLELYKKV 170
                     356678899*******************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.903161IPR002100Transcription factor, MADS-box
SMARTSM004329.2E-40160IPR002100Transcription factor, MADS-box
CDDcd002654.80E-45278No hitNo description
SuperFamilySSF554554.32E-33291IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-28323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.2E-251057IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-282338IPR002100Transcription factor, MADS-box
PRINTSPR004041.0E-283859IPR002100Transcription factor, MADS-box
PfamPF014861.4E-2385170IPR002487Transcription factor, K-box
PROSITE profilePS5129714.40986176IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008134Molecular Functiontranscription factor binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRNGLLK KAKELAILCD AEVGLIIFSS TGKLYEFSNT  60
SMKSVIERYN KTKDERQQLH NPVSELKLWQ QEAEILRQQL QDLQENHRQL MGEELCGLGV  120
KDLTNLENQL EISLRGIRME KEQILKDEIQ ELTQKGSMIH QENLELYKKV NLIRQENAEL  180
YKKAYGTRNA NTVNGNTNSP YRFIVSREVH ASIHLQLSQP EPHNFETPAG VSNSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D4e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C4e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B4e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A4e-19270169MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J5e-19269168Myocyte-specific enhancer factor 2A
3p57_I5e-19269168Myocyte-specific enhancer factor 2A
3p57_D5e-19269168Myocyte-specific enhancer factor 2A
3p57_C5e-19269168Myocyte-specific enhancer factor 2A
3p57_B5e-19269168Myocyte-specific enhancer factor 2A
3p57_A5e-19269168Myocyte-specific enhancer factor 2A
3kov_J5e-19269168Myocyte-specific enhancer factor 2A
3kov_I5e-19269168Myocyte-specific enhancer factor 2A
3kov_B5e-19269168Myocyte-specific enhancer factor 2A
3kov_A5e-19269168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755143e-61HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
GenBankHG9754413e-61HG975441.1 Solanum pennellii chromosome ch02, complete genome.
GenBankAC2153773e-61AC215377.2 Solanum lycopersicum cultivar Heinz 1706 chromosome 2 clone C02HBa0073P13, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507439.11e-173PREDICTED: MADS-box transcription factor 23-like isoform X1
SwissprotQ6EP491e-109MAD27_ORYSJ; MADS-box transcription factor 27
TrEMBLK4BCV31e-152K4BCV3_SOLLC; Uncharacterized protein
STRINGSolyc02g091550.1.11e-151(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA6792056
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37940.11e-107AGAMOUS-like 21