PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507301.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 432aa    MW: 48819 Da    PI: 6.7553
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507301.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.61.1e-093593961954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gL+++qV++WF N R +
  XP_016507301.1 359 FEHflHPYPNDSEKLMLASQTGLSKNQVSNWFINARVR 396
                     554459******************************88 PP

2BELL102.53e-33221292172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er+el  k+ kL++lleeV++rY+qy++ ++ + s Fe++ag g+ kpYt+lAl+a+SrhF cL+dai++qi
  XP_016507301.1 221 ERHELYVKIMKLITLLEEVERRYEQYYQHMEEITSTFEVIAGFGAGKPYTALALQAMSRHFSCLRDAIISQI 292
                     799********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005747.1E-30153290IPR006563POX domain
PfamPF075261.4E-37159288IPR006563POX domain
PROSITE profilePS5007111.985337400IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-27339414IPR009057Homeodomain-like
CDDcd000861.09E-10340401No hitNo description
SMARTSM003891.5E-9340404IPR001356Homeobox domain
SuperFamilySSF466891.41E-17346407IPR009057Homeodomain-like
PfamPF059202.9E-17357396IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 432 aa     Download sequence    Send to blast
MVSTDSPPPT HSSILHQFIN SDSITSQIGS QHFDIYQSGL SANTTTYQPP GVLSRSIEFV  60
NPSQFTTDSD VNNSRHLMDL LGASHDANHQ TQRLSLSLSS HSLVSSLHCR ERALSSSFTN  120
PSYISQEIDQ RNNEFSFSAA AMNQSFSNVC GTESFVSAIG NSKYLKPAQS LLEELVCAGG  180
KTIDLSNEKF IRRLSRNSKK GSLSLRALLK AEIPSNELFN ERHELYVKIM KLITLLEEVE  240
RRYEQYYQHM EEITSTFEVI AGFGAGKPYT ALALQAMSRH FSCLRDAIIS QINVIRQKMP  300
RDVPKISSGL SHLSLFEKET LQNRMPLQQL GIIQSNRQAW RPIRGLPETS VAILRSWLFE  360
HFLHPYPNDS EKLMLASQTG LSKNQVSNWF INARVRLWKP MIEEMYKEEF AESSVDSDPF  420
LNREGVTDSA EE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A4e-16346404563Homeobox protein Meis2
3k2a_B4e-16346404563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3759650.0AF375965.1 Lycopersicon esculentum bell-like homeodomain protein 1 (BL1) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507301.10.0PREDICTED: BEL1-like homeodomain protein 11
SwissprotQ1PFD17e-99BLH11_ARATH; BEL1-like homeodomain protein 11
TrEMBLM0ZWL80.0M0ZWL8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096090.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA86022228
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75430.19e-93BEL1-like homeodomain 11