PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016507300.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 525aa    MW: 59328 Da    PI: 5.8196
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016507300.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.21.5e-093143511954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +e+  LA+++gLt +qV +WF N R +
  XP_016507300.1 314 FEHflHPYPKDSEKIMLARQTGLTRSQVANWFINARVR 351
                     554459******************************88 PP

2BELL119.71.3e-38180251172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r++l++k +k  s+l+eVd+rYk y++q+q+v+ssFe+vaglg+akpYtslAlk+iSr+FrcL+dai++qi
  XP_016507300.1 180 DRHDLESKMTKFFSMLDEVDRRYKEYYQQMQAVVSSFEMVAGLGAAKPYTSLALKTISRQFRCLRDAIKKQI 251
                     6899*******************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.5E-55104249IPR006563POX domain
PfamPF075261.5E-46110247IPR006563POX domain
PROSITE profilePS5007112.341292355IPR001356Homeobox domain
CDDcd000864.41E-12295356No hitNo description
SMARTSM003894.4E-10295359IPR001356Homeobox domain
SuperFamilySSF466892.14E-17296361IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.1E-28298361IPR009057Homeodomain-like
PfamPF059201.7E-17312351IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MRCCSFHQPV NRELFVPNVE QSLQNQGLSL SLGTQVPPSL HVYSYQDDYT NSSLSSLVGT  60
HVLHSEQGSE NKESKVAEYL SFDLSRGTRA ANNPQNSMSL RDMNSGARSI YNSKYLKAAQ  120
DLLDEVVNVQ EALKQSDRLR NFNLLGQDRS EEADLKSSCS ASGISGDHNN STKGELSPAD  180
RHDLESKMTK FFSMLDEVDR RYKEYYQQMQ AVVSSFEMVA GLGAAKPYTS LALKTISRQF  240
RCLRDAIKKQ IQATRRSLGE QGDSQGERLY RLRYVDQQLR QQRSLQQFGM MRQPWRPQRG  300
LPETAVSVLR AWLFEHFLHP YPKDSEKIML ARQTGLTRSQ VANWFINARV RLWKPMIEDM  360
YKEEFGEAEA GSGASPDRAP EESKEKSIAE NTGEEIPESF TTPAVNCSHL DPSDESSNVV  420
TNVQNNSFTT KFIFQDGTYE HEKIDAVNTY HASMLGDIMG NQVSLALRLQ NSQIDQQPIS  480
GRAQLAEDDK TGSTLDISKG EYYYIDPVNQ QERFSGPHLL SDFVA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A7e-17301358158Homeobox protein Meis1
4xrs_B7e-17301358158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-165HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankHG9754431e-165HG975443.1 Solanum pennellii chromosome ch04, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016507300.10.0PREDICTED: BEL1-like homeodomain protein 7 isoform X2
TrEMBLM0ZWL90.0M0ZWL9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000096100.0(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-100BEL1-like homeodomain 6