PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506663.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 462aa    MW: 50164.9 Da    PI: 8.0301
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506663.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40168245178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +CqvegC+ dls+akey+r+h+vCe hsk+p+v+++g+ +rfCqqCsrfh+lsefDe+krsCrrrL++hn+rrrk+q+
  XP_016506663.1 168 RCQVEGCNLDLSSAKEYYRKHRVCENHSKCPKVIIAGVLRRFCQQCSRFHSLSEFDEKKRSCRRRLSDHNARRRKPQQ 245
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-33162230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.257166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036126.28E-38167248IPR004333Transcription factor, SBP-box
PfamPF031101.6E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 462 aa     Download sequence    Send to blast
MEWNAKWDWG NLVMFGSEVA KSPKELQLTD WGVEEDGELD AGSFNLSSGG SGSGTGGYVS  60
DVGCGSSIKS SISASTDSSP KEGLKASDFS FDGSPEDLSK KVKPCSRNSP PMEAPVGSVE  120
PLVGLKLGKR TFETIGGAKV SSFPDKHVSS AAAAKKTKSS TQNAPTPRCQ VEGCNLDLSS  180
AKEYYRKHRV CENHSKCPKV IIAGVLRRFC QQCSRFHSLS EFDEKKRSCR RRLSDHNARR  240
RKPQQETIQF NSARLSSLFY DSRQPMNLVL NHSNLVQCRA AANSTWESTE ETKFSITRGL  300
APKPERDGST NGQSLLPGIQ FSRAVGAHGN VSSCLLLPSK GHTAEVFNRG AKESMFNMGT  360
GPEFPRALSL LSTNSWGSSE PETVSLNHPT HANQSSMPEQ MMQAIPQGVP LLSCEYWQGD  420
GQPSSDPRDH TLAANSHAGG SFQGIELFKP PFDTDFYLNA LN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A7e-261692421184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1224241KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0727210.0LC072721.1 Nicotiana tabacum NtabSPL2 mRNA for squamosa promoter binding protein spl2, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009620618.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_009620619.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_009620620.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016506660.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016506661.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016506662.10.0PREDICTED: squamosa promoter-binding-like protein 3
RefseqXP_016506663.10.0PREDICTED: squamosa promoter-binding-like protein 3
TrEMBLA0A1S4CZU60.0A0A1S4CZU6_TOBAC; squamosa promoter-binding-like protein 3
STRINGXP_009620616.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.37e-57squamosa promoter binding protein-like 2