PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506107.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 479aa    MW: 52983.7 Da    PI: 5.9639
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506107.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.64.5e-23202244244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  XP_016506107.1 202 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 244
                     69***************************************98 PP

2QLQ51.92.2e-18138172236
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     +FT++Q+ +L++Q+++yKy+++  PvPp+Ll+ i+
  XP_016506107.1 138 PFTWSQWKELERQAMIYKYMVSAIPVPPDLLLSIC 172
                     8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.6E-10137173IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-13138172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.147138173IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213201245IPR014977WRC domain
PfamPF088794.4E-19203244IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 479 aa     Download sequence    Send to blast
MGMEDGAING FNVSNKANLD VGKISTTTAI CYNFQLQTTE SFPSKIMMGH NQDPHRSFSD  60
EDDDGGGGDS GPTLNHSGAN KMPSSNEHNV YSDASFLLPP PSPLPATGAA AVVRTFQPFD  120
ISTNSSPVEG MAAALGFPFT WSQWKELERQ AMIYKYMVSA IPVPPDLLLS ICTNSSGASH  180
TTTSASGSGS VQGQRCRNIR DLEPGRCKRT DGKKWRCSRD VAPHQKYCER HMHRGRPRSR  240
KHVEVHATLS NNNDNKKTRN HPVPLESTPI AVPKPPPTGQ TDSRSTQPLR SAFQYMEGPL  300
FLHDKMGQNI STDSSFNELH RSSGWTMEGE LVAKAGVGQQ WQHLMESNIH PADWQDSYRE  360
EALNLLACRD LERTEDVSMR HNGEFNFMIN PELLSLDKQS VKEAPRDLIN AWSNDNIYNN  420
SNDDNMEEAS LWPSQGNISP SSLTLSMAMA AGNALDEDMG LESSVMNNAY QNKSWEKFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-65HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506107.10.0PREDICTED: uncharacterized protein LOC107823908 isoform X2
TrEMBLA0A1S4CY900.0A0A1S4CY90_TOBAC; uncharacterized protein LOC107823908 isoform X2
STRINGXP_009597554.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-36growth-regulating factor 7