PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016506106.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 480aa    MW: 53054.8 Da    PI: 5.9639
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016506106.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC72.64.5e-23203245244
             WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                      epgrC+RtDGKkWRCsr+v + +k+CErH+hrgr rsrk++e
  XP_016506106.1 203 LEPGRCKRTDGKKWRCSRDVAPHQKYCERHMHRGRPRSRKHVE 245
                     69***************************************98 PP

2QLQ51.92.2e-18138172236
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     +FT++Q+ +L++Q+++yKy+++  PvPp+Ll+ i+
  XP_016506106.1 138 PFTWSQWKELERQAMIYKYMVSAIPVPPDLLLSIC 172
                     8*******************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009519.6E-10137173IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088802.7E-13138172IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166619.147138173IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.213202246IPR014977WRC domain
PfamPF088794.4E-19204245IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 480 aa     Download sequence    Send to blast
MGMEDGAING FNVSNKANLD VGKISTTTAI CYNFQLQTTE SFPSKIMMGH NQDPHRSFSD  60
EDDDGGGGDS GPTLNHSGAN KMPSSNEHNV YSDASFLLPP PSPLPATGAA AVVRTFQPFD  120
ISTNSSPVEG MAAALGFPFT WSQWKELERQ AMIYKYMVSA IPVPPDLLLS ICTNSSGASH  180
TTTSAASGSG SVQGQRCRNI RDLEPGRCKR TDGKKWRCSR DVAPHQKYCE RHMHRGRPRS  240
RKHVEVHATL SNNNDNKKTR NHPVPLESTP IAVPKPPPTG QTDSRSTQPL RSAFQYMEGP  300
LFLHDKMGQN ISTDSSFNEL HRSSGWTMEG ELVAKAGVGQ QWQHLMESNI HPADWQDSYR  360
EEALNLLACR DLERTEDVSM RHNGEFNFMI NPELLSLDKQ SVKEAPRDLI NAWSNDNIYN  420
NSNDDNMEEA SLWPSQGNIS PSSLTLSMAM AAGNALDEDM GLESSVMNNA YQNKSWEKFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754424e-65HG975442.1 Solanum pennellii chromosome ch03, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016506106.10.0PREDICTED: uncharacterized protein LOC107823908 isoform X1
TrEMBLA0A1S4CYA20.0A0A1S4CYA2_TOBAC; uncharacterized protein LOC107823908 isoform X1
STRINGXP_009597554.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-36growth-regulating factor 7