PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016505998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 563aa    MW: 63765.6 Da    PI: 6.9666
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016505998.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox283.8e-094825201854
                     HHHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  18 lFek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     +F++  ++yp+ +e++ LA k gLt +qV++WF N R +
  XP_016505998.1 482 MFQNflHPYPKDAEKQLLAVKSGLTRSQVSNWFINARVR 520
                     5887779******************************88 PP

2BELL73.33.8e-24355422371
            BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                     ++ ++kk +L+ ll+ Vd++Y+q+ +++++vis+F+av++l++  +++++Al++iS  +++L+++i++ 
  XP_016505998.1 355 MNSEAKKKHLVALLQVVDDQYNQCLDEIHMVISAFHAVTELNP-SIHARFALQTISSLYKNLRERISNY 422
                     56799**************************************.9*********************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.1E-17289421IPR006563POX domain
PfamPF075266.7E-25295420IPR006563POX domain
PROSITE profilePS5007111.224461524IPR001356Homeobox domain
SMARTSM003895.5E-7464528IPR001356Homeobox domain
CDDcd000862.97E-11464525No hitNo description
SuperFamilySSF466891.59E-15466533IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.3E-26467530IPR009057Homeodomain-like
PfamPF059204.1E-15481520IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 563 aa     Download sequence    Send to blast
MAEPHTIIDE NFLHTASIPI SFPDRVGLNN QNHVMDGQNH IMDGHEIPIP FMLQGEAINS  60
SQDFLSLPNF PRAVDTGAIH SVLPMRNRIK EFSLSTSYPI NNAYTEDQYM EGIPISAVSL  120
ANLLATRNAM PENHENLAAL ASLSHPVEGH KTDVLDYPTM LNHSFGSYRN YEFDGVPEIA  180
GTIVGRTGSQ PFQLSHENVN SNTWFSSETA SMNSDSPSGS SSRFSNELSL SLTSTQSGVA  240
CGTTIRDQCS DISCSGVTNH AFPQRRFDSE LTSCNSRNLS LNFGSYKPVH LSQFLTGSRY  300
LRVMQEILSE MAHLSLQNHN LVGYRGNGAE YGANTSFTLS SDDLPDEDRR IIGQMNSEAK  360
KKHLVALLQV VDDQYNQCLD EIHMVISAFH AVTELNPSIH ARFALQTISS LYKNLRERIS  420
NYILAMGEHF NRGGERGVEK SFETSFIQKQ WALQQLKRKD HQLWRPQRGL PERSVSVLRA  480
WMFQNFLHPY PKDAEKQLLA VKSGLTRSQV SNWFINARVR LWKPMIEEMY AEMNRRKIRT  540
GNHEDETNNR RNHKIDNRLF TMK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-14470528563Homeobox protein Meis2
3k2a_B1e-14470528563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754470.0HG975447.1 Solanum pennellii chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505998.10.0PREDICTED: homeobox protein ATH1-like
SwissprotP487311e-105ATH1_ARATH; Homeobox protein ATH1
TrEMBLK4CLC20.0K4CLC2_SOLLC; Uncharacterized protein
STRINGSolyc08g065420.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA82612327
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32980.11e-103homeobox gene 1