PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016505823.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 196aa    MW: 21722.2 Da    PI: 7.3672
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016505823.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260139.41.2e-4311109199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC ++C++apyfp e+p kfanvhk+FGasnv+kll+++++++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l++el+
  XP_016505823.1  11 PCAACKFLRRKCLPGCIFAPYFPPEEPTKFANVHKIFGASNVSKLLNEIQPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQKELD 105
                     7*********************************************************************************************9 PP

          DUF260  96 llke 99 
                     ++++
  XP_016505823.1 106 ATNA 109
                     9876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089127.30510111IPR004883Lateral organ boundaries, LOB
PfamPF031954.8E-4311108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MASSSSYSNP PCAACKFLRR KCLPGCIFAP YFPPEEPTKF ANVHKIFGAS NVSKLLNEIQ  60
PHQREDAVNS LAYEAEARMK DPVYGCVGAI SVLQRQVIRL QKELDATNAD LMRYTNREVN  120
NSHAYNNPSG GAMNNQMVNQ QRSNLNYGRR MGPVDGTATG FDQTYGFCIP NYSPNTWNSN  180
TISGNHNPEA DDDSSM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A5e-6621212121LOB family transfactor Ramosa2.1
5ly0_B5e-6621212121LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtNot known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009597524.11e-147PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_016505823.11e-147PREDICTED: LOB domain-containing protein 25-like
RefseqXP_018625398.11e-147PREDICTED: LOB domain-containing protein 25-like isoform X1
RefseqXP_018625399.11e-147PREDICTED: LOB domain-containing protein 25-like isoform X1
SwissprotQ8L8Q32e-67LBD25_ARATH; LOB domain-containing protein 25
SwissprotQ9FML43e-67LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES
TrEMBLA0A1S4CXF41e-146A0A1S4CXF4_TOBAC; LOB domain-containing protein 25-like
STRINGXP_009597524.11e-146(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.17e-70LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Xu C, et al.
    Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration.
    Nat Plants, 2018. 4(2): p. 108-115
    [PMID:29358751]
  3. Liu J, et al.
    The WOX11-LBD16 Pathway Promotes Pluripotency Acquisition in Callus Cells During De Novo Shoot Regeneration in Tissue Culture.
    Plant Cell Physiol., 2018. 59(4): p. 734-743
    [PMID:29361138]