PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016505401.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 469aa    MW: 51456.5 Da    PI: 7.124
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016505401.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.32.7e-23165208144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+ep+rC+RtDGKkWRC r+v +++k+CErH h+++ rsrk++e
  XP_016505401.1 165 DPEPWRCKRTDGKKWRCTRDVAPDQKYCERHAHKSKPRSRKPVE 208
                     79***************************************987 PP

2QLQ36.91.1e-13106141237
             QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 
                     +FTa+Qlq++ +Q  + Ky++a++PvPp+Ll+++++
  XP_016505401.1 106 PFTASQLQEFQRQTIICKYIMASVPVPPQLLLPLSN 141
                     9********************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009516.3E-5105141IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.823106141IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088806.4E-10106139IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.489165209IPR014977WRC domain
PfamPF088791.1E-18166208IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MGNGENTELL DLKMKTTESS PSSYPYKRTM FLPPSSHPHF AAFDKETSSN STCLAGGGGG  60
GGNGDFEGSD SYDAVSSGAA AALSSRPLQP FSCSARGSMF LSGKAPFTAS QLQEFQRQTI  120
ICKYIMASVP VPPQLLLPLS NNPSSAHLPQ SNTSGLDLKF SRGSDPEPWR CKRTDGKKWR  180
CTRDVAPDQK YCERHAHKSK PRSRKPVEIH NTNNNNNNSN NRHPPTPTSR NHHHSFQFPT  240
VQLSDQTRCI EWLGRGDRGG TIPIISCNQQ NLQQLMQSSS GMGFNNDYTD QNRRNTPAFQ  300
MQDESKVYPM NNFNQYISNR SSNQTLESTP LKNEECSDSI IASLQGRTTR DFIDAWSKDG  360
LNDGINNNGS FTSLTLSMSG WNHGMDEDNE NAQVSINRML DSERSSDEVL RSQWLNPVSW  420
MSSTAPGGPL GEALCLGNAT NLPSPHGYSN STANSSCSFN SCENSSHGL
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505401.10.0PREDICTED: growth-regulating factor 8-like
TrEMBLA0A1S4CWA20.0A0A1S4CWA2_TOBAC; growth-regulating factor 8-like
STRINGXP_009625634.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA125171820
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24150.16e-27growth-regulating factor 8