PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016505306.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 366aa    MW: 39338 Da    PI: 7.9625
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016505306.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.43.7e-4273148176
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                     +CqvegC++dls+ak y++rhkvC +hsk+p+v+v+gleqrfCqqCsrfh+l efD++krsCrrrLa hnerrrk+
  XP_016505306.1  73 RCQVEGCQVDLSDAKAYYSRHKVCGMHSKSPTVIVAGLEQRFCQQCSRFHQLPEFDQGKRSCRRRLACHNERRRKP 148
                     6*************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.2E-3567135IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.03571148IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.2E-3972151IPR004333Transcription factor, SBP-box
PfamPF031101.3E-3174147IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008361Biological Processregulation of cell size
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0042127Biological Processregulation of cell proliferation
GO:0048653Biological Processanther development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 366 aa     Download sequence    Send to blast
MNGQWNSVME LGSVSSPGSN SSSSDSLNGL NFGKKIYFEN VGGGSSPVTG AGNLPPASKR  60
GRGGLMQGGQ PPRCQVEGCQ VDLSDAKAYY SRHKVCGMHS KSPTVIVAGL EQRFCQQCSR  120
FHQLPEFDQG KRSCRRRLAC HNERRRKPPS GSLFSTHYGS LSSSIFENNS SKSGSFLLDF  180
SSHPHVNESS WPNTRASEQG WDHQSTASGK CLQRPWLNNS ENATSELVLQ GSATRTNYVP  240
SGECFSGVSD SSTGALSLLS NRSWGSRNPP SSLGANIDGI HTIQPSDSHG APTNHFSSPS  300
LRFKGNEASS SSHEMPSDLG LGQISQAADD QYCGELGIGQ QSGRQNMELD HSNGYHPSVQ  360
NVHWSL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A6e-30741471184squamosa promoter binding protein-like 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00412DAPTransfer from AT3G57920Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2445801e-129AC244580.4 Solanum lycopersicum strain Heinz 1706 chromosome 10 clone hba-40g6 map 10, complete sequence.
GenBankHG9755221e-129HG975522.1 Solanum lycopersicum chromosome ch10, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016505306.10.0PREDICTED: squamosa promoter-binding-like protein 9
TrEMBLA0A1S4CW140.0A0A1S4CW14_TOBAC; squamosa promoter-binding-like protein 9
STRINGXP_009776998.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45712241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.11e-52squamosa promoter binding protein-like 15