PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504711.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 474aa    MW: 51760.4 Da    PI: 8.2704
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504711.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP1261.5e-39185262178
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                     +C vegC+ dls+akeyhr+h+vC+ hsk+p+v++ g e+rfCqqCsrfh+ls+fDe+krsCrrrL++hn+rrrk+q+
  XP_016504711.1 185 RCLVEGCNLDLSSAKEYHRKHRVCHSHSKCPKVIIGGAERRFCQQCSRFHSLSDFDEKKRSCRRRLSDHNARRRKPQQ 262
                     6**************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.103.4E-31179247IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.752183260IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.66E-37184265IPR004333Transcription factor, SBP-box
PfamPF031106.0E-30186259IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 474 aa     Download sequence    Send to blast
MEWNVKWEWG DLMMFGSEAC GSPKELQLTD WGVDEEGELD RRSFNLSGFG SSVGGYGSDM  60
GRSSSIKSSI SASTDSSPNE XSTDSSPNET LKASSFTFEA SNGSQGNLGK DVEQCRDELS  120
RCSPPMEALI GYDGPLTGLK LGKRTVESNS GGSSVKLPSS SSIPVSSVSA AKKKKSSSQN  180
ALIPRCLVEG CNLDLSSAKE YHRKHRVCHS HSKCPKVIIG GAERRFCQQC SRFHSLSDFD  240
EKKRSCRRRL SDHNARRRKP QQETIQFNST RLSSWFYDNS KSMNFVFNNG LLLQSKTTAD  300
STRGTSEVPK FTITRGLTSK PYKAGSINVQ SLVGEIKLPG ATKMQTDASK GTTTEVFSQG  360
VKENMLSLNM GAEPELPRAL SLLSNKSSSE PESTSIGHPT HVNSIGHPTH VNQISITEQQ  420
VILENSPLGS TEHWQAEQYL LNPRIHALVA NGHSGGSFQL SKDPFDNFYF NGLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A4e-241862591184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1241258KKRSCRRRLSDHNARRRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016504684.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_016504693.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_016504699.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_016504706.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
RefseqXP_016504711.10.0PREDICTED: squamosa promoter-binding-like protein 12 isoform X1
TrEMBLA0A1S4CUA30.0A0A1S4CUA3_TOBAC; squamosa promoter-binding-like protein 12 isoform X1
STRINGXP_009613083.10.0(Nicotiana tomentosiformis)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43270.32e-46squamosa promoter binding protein-like 2