PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504574.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 657aa    MW: 73830.4 Da    PI: 6.6662
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504574.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox29.31.4e-094594961954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps++++  L++++gL+++qV++WF N R +
  XP_016504574.1 459 FEHflHPYPSEADKHLLSRQTGLSKNQVSNWFINARVR 496
                     554459******************************88 PP

2BELL108.93e-35319390172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     er e q++k kLls+l+eVd rY +y+eq+q++++sF+ ++g+g+a+pYt+lA+ka+SrhFrc+kdai+ q+
  XP_016504574.1 319 ERSEYQRRKIKLLSMLDEVDARYTRYCEQMQAMVNSFDSMIGYGAAAPYTALAQKAMSRHFRCIKDAIVAQL 390
                     789******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.0E-56254388IPR006563POX domain
PfamPF075264.8E-48259387IPR006563POX domain
PROSITE profilePS5007112.422437500IPR001356Homeobox domain
SMARTSM003891.8E-9440504IPR001356Homeobox domain
CDDcd000861.28E-11440501No hitNo description
SuperFamilySSF466896.84E-17441507IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.5E-28443506IPR009057Homeodomain-like
PfamPF059207.2E-18457496IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 657 aa     Download sequence    Send to blast
MSQSFQQGFY NFSSVYERSA TKHEDMLRIQ GFEPLPPPPQ QVEEPSGAVY DGGGMLTEII  60
SYPSAWRKAA TDILDDQIQS SNYRQWPQKE QQQLLPPSIN EVELPLMNSH IKASSPPRSS  120
SSLHMLLPNS ADTNSLLHHQ GFHLLNSTAV EPPSQFTWVP GSSSGEDNST RIGRVVDGQG  180
LSLSLSRNFE AAAKLEDLRI GNGGIYLNNN QGLFGAINNN NNHHQLLHSG VIMDHRTAPH  240
SNHQVHVGYA AASPRMTNVL RNSRYVKAAQ ELLEEFCCVG RGNFKNQRVK KYEDENPNSN  300
TESEDRGSLK DHPPLSAAER SEYQRRKIKL LSMLDEVDAR YTRYCEQMQA MVNSFDSMIG  360
YGAAAPYTAL AQKAMSRHFR CIKDAIVAQL KQTCKYLGEK DVTGSGGLTK GETPRLKMLD  420
QKLRQQKALH QMGMLDSDAW RPQRGLPERS VNVLRAWLFE HFLHPYPSEA DKHLLSRQTG  480
LSKNQVSNWF INARVRLWKP MVEEMYQQET KEEETDQDQE EEEQENQVSA QTLMHDKISN  540
MATSATTTTM PLSVRSEFNA NERDLSKNII NYRQYALGNQ LVMLQDDTAT ASSATHDVST  600
TVNRYFTAAD AADLVANSNA TFGSQPAGDV SLTLGLRHSE NVPRKTTQFQ LRDFGAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A1e-16446504563Homeobox protein Meis2
3k2a_B1e-16446504563Homeobox protein Meis2
4xrm_A1e-16446504563Homeobox protein Meis2
4xrm_B1e-16446504563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755161e-111HG975516.1 Solanum lycopersicum chromosome ch04, complete genome.
GenBankCU4590251e-111CU459025.8 S.lycopersicum DNA sequence from clone LE_HBa-223O22 on chromosome 4, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009773433.10.0PREDICTED: BEL1-like homeodomain protein 4
RefseqXP_016504574.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLK4BV620.0K4BV62_SOLLC; Uncharacterized protein
STRINGSolyc04g079830.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA60721721
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-126BEL1-like homeodomain 2