PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016504479.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 647aa    MW: 72200.4 Da    PI: 5.1508
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016504479.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.42.7e-094114481954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_016504479.1 411 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 448
                     664459******************************88 PP

2BELL126.21.2e-40273344172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     e+qe+q+k +kLls+l+e+d+rY+qy++q+q+v+ssF++vag g+akpYt+lAl++iSrhFrcL+dai++qi
  XP_016504479.1 273 EKQEVQNKLTKLLSMLDEIDRRYRQYYHQMQIVVSSFDVVAGDGAAKPYTALALQTISRHFRCLRDAICDQI 344
                     689********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.2E-60195342IPR006563POX domain
PfamPF075261.4E-50201340IPR006563POX domain
PROSITE profilePS5007112.163389452IPR001356Homeobox domain
SMARTSM003891.0E-9392456IPR001356Homeobox domain
CDDcd000863.42E-12392453No hitNo description
SuperFamilySSF466892.27E-17393459IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-29395458IPR009057Homeodomain-like
PfamPF059204.3E-18409448IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 647 aa     Download sequence    Send to blast
MATYFPSPNS QREAETFQYF RQSLPGSYSE ASNAPENMMV FMNYSSSGTY SDMLTGTSQQ  60
QNSCVDIPPV GDSDSNNTSQ QEILSNLGGS RMGIHDFSAW RDSRNEMLYL SLGSNIPSGI  120
GISHVQSQNP NQGFTSFLNP ASSIPGEVSG GNVSFGDGDN SQPKQQRNSD YLPPDYAGSN  180
SDAMKGGYNS PYGTLSIGRK VPNSKYLKAA QYLLDEVVNV RKAIKEHNSK KEFTKESRES  240
DGDSKNKSSD PPANGSSNPQ DSKNHQSELS QTEKQEVQNK LTKLLSMLDE IDRRYRQYYH  300
QMQIVVSSFD VVAGDGAAKP YTALALQTIS RHFRCLRDAI CDQIRASRRS VGEQDASENS  360
KAIGISRLRY VDQHIRQQRA LQQLGMMQQH AWRPQRGLPE SSVSILRAWL FEHFLHPYPK  420
DSDKIMLARQ TGLTRSQVSN WFINARVRLW KPMVEEMYKE EAGDTEMNSN SSSDFASRLA  480
SKDSKVEETE ELKRNETSEY EQYNSDQILE SKSNHVADVE MEGANNAETQ SQSGMENQTQ  540
RDEPRPAMDN CTLFQDTFVQ GNDRFSDFGR FGSGNVLPNG VSLTLGLQQG EGSSLPMSIE  600
SHGSYVPLRV DEIYSTAPTT MVSETAEFNC LDSGSRQHPF WLLPSAT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A3e-16398456563Homeobox protein Meis2
3k2a_B3e-16398456563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4067030.0AF406703.1 Solanum tuberosum BEL1-related homeotic protein 30 (Bel30) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016504479.10.0PREDICTED: BEL1-like homeodomain protein 7
TrEMBLK4B3L10.0K4B3L1_SOLLC; Uncharacterized protein
STRINGSolyc01g109980.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA102052226
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-127BEL1-like homeodomain 6