PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016503570.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 188aa    MW: 21149.3 Da    PI: 6.295
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016503570.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260122.62.1e-3815111197
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +C+aCk+lrr+C++dC++ p+fp ++p+kf +vh++FGasn++k+l+++p ++reda+ s+vyeA ar+rdPvyG+vg+i+++q+++ +l++el+
  XP_016503570.1  15 PCSACKFLRRRCTQDCIFLPHFPTAEPQKFIAVHRIFGASNISKILQEIPVDNREDAVISMVYEATARLRDPVYGCVGIISAVQKHVFHLQSELN 109
                     7********************************************************************************************99 PP

          DUF260  96 ll 97 
                     ++
  XP_016503570.1 110 EA 111
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089124.31114115IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-4015110IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MFFMGSTNKK NKHMPCSACK FLRRRCTQDC IFLPHFPTAE PQKFIAVHRI FGASNISKIL  60
QEIPVDNRED AVISMVYEAT ARLRDPVYGC VGIISAVQKH VFHLQSELNE ALAEAMFLRT  120
QLSDALSLPS LIEGSPFTPE NHEFLHFQKP SEQNAYANAS DALLLLPEAA DHYCLQGTEV  180
LPLPYLDI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A2e-411513211126LOB family transfactor Ramosa2.1
5ly0_B2e-411513211126LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754451e-84HG975445.1 Solanum pennellii chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016503570.11e-139PREDICTED: LOB domain-containing protein 25-like isoform X2
SwissprotQ8L8Q32e-43LBD25_ARATH; LOB domain-containing protein 25
TrEMBLA0A1S4CR381e-138A0A1S4CR38_TOBAC; LOB domain-containing protein 25-like isoform X2
STRINGSolyc06g082770.2.16e-90(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27650.19e-46LOB domain-containing protein 25
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]