PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016503027.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 260aa    MW: 29992 Da    PI: 6.7954
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016503027.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF88.82.9e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    krienk+ rqvtfskRr+g+lKK +ELSvLCda++ +iifss+gkl+eyss
  XP_016503027.1  9 KRIENKTSRQVTFSKRRAGLLKKTHELSVLCDAQIGLIIFSSKGKLFEYSS 59
                    79***********************************************96 PP

2K-box62.41.8e-21821671196
           K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 
                     + +  +l+ e++k+k+ + nLq ++ +++G+dL+s +++eL++Le+qLe +++k+R++K+el+ +q+e+l++ ek+l+++n+++ +
  XP_016503027.1  82 QDNRVELYDEITKMKRDTLNLQLSLQRYKGDDLSSAQYEELNELEKQLEFAVNKVRARKQELMQQQMENLRRTEKMLEKDNQEMYQ 167
                     44566899*************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004321.4E-39160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.749161IPR002100Transcription factor, MADS-box
CDDcd002651.75E-43278No hitNo description
SuperFamilySSF554553.27E-31279IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-30323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003191.6E-241057IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004044.8E-303859IPR002100Transcription factor, MADS-box
PfamPF014862.8E-1985168IPR002487Transcription factor, K-box
PROSITE profilePS5129714.07685180IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MGRGKIEVKR IENKTSRQVT FSKRRAGLLK KTHELSVLCD AQIGLIIFSS KGKLFEYSSQ  60
PHSMSEIISR YLQTTGASIP VQDNRVELYD EITKMKRDTL NLQLSLQRYK GDDLSSAQYE  120
ELNELEKQLE FAVNKVRARK QELMQQQMEN LRRTEKMLEK DNQEMYQWLM SNQMNKQQSA  180
SVMEHNDEEA ITELNLMGEQ PLLSQFSFFG EEQVQPSSIN VLQLAAASYS TTTCAYRLQP  240
SHPKLHDSDL PGCSYAHLKD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_A8e-19271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B8e-19271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C8e-19271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_D8e-19271168MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1tqe_R1e-18171169Myocyte-specific enhancer factor 2B
1tqe_S1e-18171169Myocyte-specific enhancer factor 2B
3kov_A9e-19271168Myocyte-specific enhancer factor 2A
3kov_B9e-19271168Myocyte-specific enhancer factor 2A
3kov_I9e-19271168Myocyte-specific enhancer factor 2A
3kov_J9e-19271168Myocyte-specific enhancer factor 2A
3mu6_A6e-19271168Myocyte-specific enhancer factor 2A
3mu6_B6e-19271168Myocyte-specific enhancer factor 2A
3mu6_C6e-19271168Myocyte-specific enhancer factor 2A
3mu6_D6e-19271168Myocyte-specific enhancer factor 2A
3p57_A9e-19271168Myocyte-specific enhancer factor 2A
3p57_B9e-19271168Myocyte-specific enhancer factor 2A
3p57_C9e-19271168Myocyte-specific enhancer factor 2A
3p57_D9e-19271168Myocyte-specific enhancer factor 2A
3p57_I9e-19271168Myocyte-specific enhancer factor 2A
3p57_J9e-19271168Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009616464.10.0PREDICTED: MADS-box protein FBP24
RefseqXP_009616465.10.0PREDICTED: MADS-box protein FBP24
RefseqXP_016503027.10.0PREDICTED: MADS-box protein FBP24-like
SwissprotQ9ATE51e-140FBP24_PETHY; MADS-box protein FBP24
TrEMBLK4D4C51e-128K4D4C5_SOLLC; Uncharacterized protein
STRINGSolyc11g005120.1.11e-127(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G23260.22e-64MIKC_MADS family protein