PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502910.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 250aa    MW: 28301.3 Da    PI: 9.0071
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502910.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF100.18.4e-32958150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krienk+nrqvtfskRrng+lKKA+ELSvLCdaeva+iifss+gklye+ 
  XP_016502910.1  9 KRIENKINRQVTFSKRRNGLLKKAYELSVLCDAEVALIIFSSRGKLYEFG 58
                    79**********************************************95 PP

2K-box1034e-3480169998
           K-box   9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                       e++++s++qe++kLk++ e Lqr+qRhllGedL++LslkeLq+Le+qLe +l + R++K++++ eq+eel++ke++l + nk+L+ k+
  XP_016502910.1  80 CGERETQSWYQEVSKLKAKFEALQRTQRHLLGEDLGPLSLKELQNLEKQLEGALAQARQRKTQIMAEQMEELRRKERQLGDVNKQLKIKV 169
                     67899*********************************************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.5E-42160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.683161IPR002100Transcription factor, MADS-box
CDDcd002651.09E-44272No hitNo description
SuperFamilySSF554551.7E-33277IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-33323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003193.0E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-332338IPR002100Transcription factor, MADS-box
PRINTSPR004047.3E-333859IPR002100Transcription factor, MADS-box
PfamPF014861.3E-3082169IPR002487Transcription factor, K-box
PROSITE profilePS5129716.60885179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009911Biological Processpositive regulation of flower development
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0048437Biological Processfloral organ development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 250 aa     Download sequence    Send to blast
MGRGRVELKR IENKINRQVT FSKRRNGLLK KAYELSVLCD AEVALIIFSS RGKLYEFGSS  60
GITKTLERYQ RCCLNPQDNC GERETQSWYQ EVSKLKAKFE ALQRTQRHLL GEDLGPLSLK  120
ELQNLEKQLE GALAQARQRK TQIMAEQMEE LRRKERQLGD VNKQLKIKVS LELSSLEAEG  180
QGLRPLPFPW TCNASAGSSS FAVHPSQSNH MECEPDPVLQ IGYHHYMAAE GPSGSRSMAV  240
ESNIIHGWGL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ox0_A7e-23761704102Developmental protein SEPALLATA 3
4ox0_B7e-23761704102Developmental protein SEPALLATA 3
4ox0_C7e-23761704102Developmental protein SEPALLATA 3
4ox0_D7e-23761704102Developmental protein SEPALLATA 3
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00315DAPTransfer from AT2G45650Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0310350.0AB031035.1 Petunia x hybrida pMADS4 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016502910.10.0PREDICTED: MADS-box transcription factor 6-like
SwissprotQ6EU391e-108MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBLM0ZGN71e-163M0ZGN7_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000003831e-163(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45650.13e-96AGAMOUS-like 6