PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502562.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family SBP
Protein Properties Length: 508aa    MW: 56631.4 Da    PI: 8.1856
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502562.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP132.21.7e-41216291277
                     -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     Cqv+gC++dl++ k+yh+rhkvC+ hsk++ v+v+g+eqrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  XP_016502562.1 216 CQVHGCNKDLTSSKDYHKRHKVCDEHSKTAIVIVNGIEQRFCQQCSRFHLLAEFDEGKRSCRKRLAGHNERRRKPQ 291
                     **************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.1E-33210277IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.513213290IPR004333Transcription factor, SBP-box
SuperFamilySSF1036122.75E-39214295IPR004333Transcription factor, SBP-box
PfamPF031106.2E-32216289IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 508 aa     Download sequence    Send to blast
MEPLSYGLEG RGFLFPDNVE LSVDTFSRSR NTVKEWNLNP FCDVDKSICG PSQEITESTG  60
FLESGIADIF KKSAASNPCP GALSGEIGNG SMLELGAMFN HSATKSNNPM SLPIGLKLDE  120
LTDYGEVRTS QSSKESSVLS SPESSLPTGK AAQRKSLHSQ FPISQVRGQK EEESIVYREV  180
KSNQSLKRNP DLSTVNSSLQ GKRLRTTNLH SEVPFCQVHG CNKDLTSSKD YHKRHKVCDE  240
HSKTAIVIVN GIEQRFCQQC SRFHLLAEFD EGKRSCRKRL AGHNERRRKP QFDSHWGSRF  300
LDMTQRRVPF LFPEILPGSF FYQENYEVNN NDQHLRLDRK PFCISQLAMS VTSGQSPAES  360
NQHQYGVRKQ DLSKVPVGST ILSVQEISAG QNSSCALSLL SAHSQNLLRN STGISPTLPW  420
MVKGDAHAYI KDDHHNLAKS PRVSVPEMQR DGHDQRANSM NSKNCLSPEG GPTMDLVQLS  480
SHLLRVEQQK NSVQVKQEND IFSSFAST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A8e-29211289684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLC0732940.0LC073294.1 Nicotiana tabacum NtabSPL6-6 mRNA for squamosa promoter binding protein NtabSPL6-6, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788762.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_009788763.10.0PREDICTED: squamosa promoter-binding-like protein 6
RefseqXP_016502562.10.0PREDICTED: squamosa promoter-binding-like protein 6
TrEMBLA0A1S4CMR20.0A0A1S4CMR2_TOBAC; squamosa promoter-binding-like protein 6
TrEMBLA0A1U7XD130.0A0A1U7XD13_NICSY; squamosa promoter-binding-like protein 6
STRINGXP_009788762.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.17e-57SBP family protein