PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016502483.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 307aa    MW: 34651.8 Da    PI: 7.1232
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016502483.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260137.93.5e-4371061100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrrkC+++Cv+apyfp +qp+kfanvhk+FGasnv kll++l+ ++reda++sl+yeAe r+rdPvyG+vg+i+ lq++l+q++ +l 
  XP_016502483.1   7 PCAACKFLRRKCTQECVFAPYFPPDQPQKFANVHKVFGASNVAKLLNELNATQREDAVNSLAYEAEYRLRDPVYGCVGLISVLQHKLKQVQDDLL 101
                     7********************************************************************************************98 PP

          DUF260  96 llkee 100
                      +k+e
  XP_016502483.1 102 NAKKE 106
                     88876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.7576107IPR004883Lateral organ boundaries, LOB
PfamPF031956.6E-437103IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 307 aa     Download sequence    Send to blast
MSSSNSPCAA CKFLRRKCTQ ECVFAPYFPP DQPQKFANVH KVFGASNVAK LLNELNATQR  60
EDAVNSLAYE AEYRLRDPVY GCVGLISVLQ HKLKQVQDDL LNAKKELATY IGPSAMLPIL  120
QHPGYIQQHP NNPSSSTMMP YNMQPMLGLP TGMQQQQQHG AQLMLRDPQQ QQQQNHQQVI  180
EAHQFAAAMA AREQQEMLRT YEQQPQQQQH PQFNSGFDSA GPVTATGFHQ MSSSVSPSLA  240
LGSFDNPYQI QQTQQEHCGQ VQIQPHQLLQ QQQQQQNHQQ QLPQQPQTPQ QQQRAKSEEE  300
RSIGPSC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4931107114LOB family transfactor Ramosa2.1
5ly0_B6e-4931107114LOB family transfactor Ramosa2.1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtControls the proximal-distal patterning in petals and the adaxial-abaxial determination of leaves. Involved in the repression of the homeobox gene BP. {ECO:0000269|PubMed:12787254, ECO:0000269|PubMed:15821980}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774046.10.0PREDICTED: LOB domain-containing protein 36-like
RefseqXP_016502483.10.0PREDICTED: LOB domain-containing protein 36-like
SwissprotQ9FKZ39e-84LBD36_ARATH; LOB domain-containing protein 36
TrEMBLA0A1S4CML70.0A0A1S4CML7_TOBAC; LOB domain-containing protein 36-like
TrEMBLA0A1U7W9Z50.0A0A1U7W9Z5_NICSY; LOB domain-containing protein 36-like
STRINGXP_009774046.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66870.17e-74ASYMMETRIC LEAVES 2-like 1
Publications ? help Back to Top
  1. Kim M,Kim MJ,Pandey S,Kim J
    Expression and Protein Interaction Analyses Reveal Combinatorial Interactions of LBD Transcription Factors During Arabidopsis Pollen Development.
    Plant Cell Physiol., 2016. 57(11): p. 2291-2299
    [PMID:27519310]
  2. Wang Z,Wang Y,Kohalmi SE,Amyot L,Hannoufa A
    SQUAMOSA PROMOTER BINDING PROTEIN-LIKE 2 controls floral organ development and plant fertility by activating ASYMMETRIC LEAVES 2 in Arabidopsis thaliana.
    Plant Mol. Biol., 2016. 92(6): p. 661-674
    [PMID:27605094]