PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016501014.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 166aa    MW: 18269.7 Da    PI: 7.8022
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016501014.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260145.12e-45111101100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +Ca+Ck+lrr+C +dCv+apyfpa++p+kfanvhk+FGasnv+k+l++lpe++r da+ss+vyeA+ar+rdPvyG+vg i++lqqq++ l+++la
  XP_016501014.1  11 PCAGCKLLRRRCGEDCVFAPYFPADEPHKFANVHKVFGASNVSKMLQELPEHKRGDAVSSMVYEANARVRDPVYGCVGAISSLQQQIDMLRTQLA 105
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_016501014.1 106 MAQAE 110
                     99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.67210111IPR004883Lateral organ boundaries, LOB
PfamPF031957.0E-4511108IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 166 aa     Download sequence    Send to blast
MKDCGKNSNS PCAGCKLLRR RCGEDCVFAP YFPADEPHKF ANVHKVFGAS NVSKMLQELP  60
EHKRGDAVSS MVYEANARVR DPVYGCVGAI SSLQQQIDML RTQLAMAQAE VVHLRLRQSA  120
GITNSPTNSG SPSSHIMGSH QPKGYFHMDL DVDQSNNGFN DPMWPC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A6e-4871257125LOB family transfactor Ramosa2.1
5ly0_B6e-4871257125LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009783465.11e-124PREDICTED: LOB domain-containing protein 4-like
RefseqXP_016501014.11e-124PREDICTED: LOB domain-containing protein 4-like
SwissprotQ9SHE97e-63LBD4_ARATH; LOB domain-containing protein 4
TrEMBLA0A1S4CJ261e-122A0A1S4CJ26_TOBAC; LOB domain-containing protein 4-like
TrEMBLA0A1U7XAI81e-122A0A1U7XAI8_NICSY; LOB domain-containing protein 4-like
STRINGXP_009783465.11e-123(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G31320.14e-64LOB domain-containing protein 4