PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016500314.1
Common NameSOC1, tobmads1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 219aa    MW: 25119.9 Da    PI: 9.905
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016500314.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF915.8e-291059251
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    rien + rqvtfskRrng+lKKA+ELSvLCdaev ++ifs++gklye++s
  XP_016500314.1 10 RIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVGLVIFSPRGKLYEFAS 59
                    8***********************************************86 PP

2K-box88.81.1e-2980172798
           K-box   7 ks.leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     ++ + e++ +++q+ +a L k+ie L++++R+llGe+L+s+sl eLqq+e+qLe+s+++iR++K ++++eqie+l++kek l +en  Lr+k+
  XP_016500314.1  80 ENqVGEQNLQHMQHAAASLMKKIELLEESKRKLLGEGLQSCSLVELQQIEKQLERSVSTIRARKIQVFKEQIERLKEKEKILASENAILREKF 172
                     44499*************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006631.342161IPR002100Transcription factor, MADS-box
SMARTSM004324.3E-40160IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-30323IPR002100Transcription factor, MADS-box
SuperFamilySSF554558.37E-33377IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002651.86E-41375No hitNo description
PfamPF003191.6E-261057IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-302338IPR002100Transcription factor, MADS-box
PRINTSPR004043.5E-303859IPR002100Transcription factor, MADS-box
PfamPF014868.6E-2685172IPR002487Transcription factor, K-box
PROSITE profilePS5129715.68188178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 219 aa     Download sequence    Send to blast
MVRGKTQMRR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVGLVIFSP RGKLYEFASS  60
SMQEIIERYK RHTKDKVQPE NQVGEQNLQH MQHAAASLMK KIELLEESKR KLLGEGLQSC  120
SLVELQQIEK QLERSVSTIR ARKIQVFKEQ IERLKEKEKI LASENAILRE KFGGLQQRQG  180
SSGEKEGEAL CTESSEKSDV ETELFIGPSE CRIRRPLQN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3mu6_D2e-19372271Myocyte-specific enhancer factor 2A
3mu6_C2e-19372271Myocyte-specific enhancer factor 2A
3mu6_B2e-19372271Myocyte-specific enhancer factor 2A
3mu6_A2e-19372271Myocyte-specific enhancer factor 2A
1egw_D3e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C3e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B3e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A3e-19372271MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J3e-19372271Myocyte-specific enhancer factor 2A
3p57_I3e-19372271Myocyte-specific enhancer factor 2A
3p57_D3e-19372271Myocyte-specific enhancer factor 2A
3p57_C3e-19372271Myocyte-specific enhancer factor 2A
3p57_B3e-19372271Myocyte-specific enhancer factor 2A
3p57_A3e-19372271Myocyte-specific enhancer factor 2A
3kov_J3e-19372271Myocyte-specific enhancer factor 2A
3kov_I3e-19372271Myocyte-specific enhancer factor 2A
3kov_B3e-19372271Myocyte-specific enhancer factor 2A
3kov_A3e-19372271Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJQ6869380.0JQ686938.1 Nicotiana tabacum cultivar SR1 suppressor of overexpression of CO 1 (SOC1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016500313.11e-156PREDICTED: MADS-box protein SOC1-like
RefseqXP_016500314.11e-156PREDICTED: MADS-box protein SOC1-like
SwissprotO646452e-88SOC1_ARATH; MADS-box protein SOC1
TrEMBLQ405911e-155Q40591_TOBAC; Suppressor of overexpression of CO 1
STRINGPGSC0003DMT4000000281e-104(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45660.11e-89AGAMOUS-like 20
Publications ? help Back to Top
  1. Mandel T,Lutziger I,Kuhlemeier C
    A ubiquitously expressed MADS-box gene from Nicotiana tabacum.
    Plant Mol. Biol., 1994. 25(2): p. 319-21
    [PMID:8018879]