PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016499152.1
Common Namekn1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 327aa    MW: 36743.9 Da    PI: 4.8086
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016499152.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.13.6e-092572902255
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      +yp++ee+ +L++ +gL+ +q+ +WF N+R ++
  XP_016499152.1 257 WPYPTEEEKNRLSEITGLDPKQINNWFINQRKRH 290
                     58*****************************885 PP

2ELK361.5e-12210231122
             ELK   1 ELKhqLlrKYsgyLgsLkqEFs 22 
                     ELK+ L+rKYsgyL+sL++EF+
  XP_016499152.1 210 ELKETLMRKYSGYLSSLRKEFL 231
                     9********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012551.2E-185599IPR005540KNOX1
PfamPF037901.4E-195798IPR005540KNOX1
SMARTSM012568.3E-26104155IPR005541KNOX2
PfamPF037913.2E-25107154IPR005541KNOX2
PfamPF037891.6E-9210231IPR005539ELK domain
SMARTSM011885.6E-7210231IPR005539ELK domain
PROSITE profilePS5121311.243210230IPR005539ELK domain
PROSITE profilePS5007112.584230293IPR001356Homeobox domain
SuperFamilySSF466892.1E-19232303IPR009057Homeodomain-like
SMARTSM003893.6E-13232297IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.2E-26235296IPR009057Homeodomain-like
CDDcd000861.97E-12242294No hitNo description
PfamPF059204.4E-16250289IPR008422Homeobox KN domain
PROSITE patternPS000270268291IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 327 aa     Download sequence    Send to blast
MMDELSKLHS AIACSSNNNH VVGVLEHITG QQQEGPINNS SVDNNLEKAS LEMSDLIKAQ  60
IANHPLYPNL LSAYLQCRKV GTPQEMASIL EEISKENHLI SSCHNTEIGT DPELDDFMES  120
YCAVLLKYKE ELSKPFDEAT TFLNNIESQL SSLCKENLTT TTTTTTSFNS NNNYLSDEAG  180
GTSDEDLGCR EMEAVDSTQE SPANREGDNE LKETLMRKYS GYLSSLRKEF LKKRKKGKLP  240
KDARTALLDW WNTHYRWPYP TEEEKNRLSE ITGLDPKQIN NWFINQRKRH WRPSEDMKYA  300
LMEGVSSGSI AGSMYFDGAG GTGSIGT
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1225234LRKEFLKKRK
2231235KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF5440520.0AF544052.1 Nicotiana tabacum knotted 1 (kn1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016499153.10.0PREDICTED: homeobox protein knotted-1-like 1
RefseqXP_016499152.10.0PREDICTED: homeobox protein knotted-1-like 1
SwissprotQ9FP291e-106KNOS1_ORYSJ; Homeobox protein knotted-1-like 1
TrEMBLQ717U30.0Q717U3_TOBAC; Knotted 1
STRINGPGSC0003DMT4000071591e-165(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7532480
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70510.12e-78KNOTTED-like from Arabidopsis thaliana 2