PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016498400.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 245aa    MW: 27411.6 Da    PI: 4.9939
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016498400.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF885.2e-28959151
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                    k+i+n + rqvtfskRr g++KKA ELSvLCdaeva+iifs tgkl+ey+s
  XP_016498400.1  9 KKIDNITARQVTFSKRRRGLFKKAAELSVLCDAEVALIIFSATGKLFEYAS 59
                    68***********************************************86 PP

2K-box462.3e-16961712499
           K-box  24 LkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkle 99 
                     L ke+    re+R+++Ge+Le Lsl+ Lqq+e++Le +l+++ + K   ++++i +lq+k   l eenk+L++k++
  XP_016498400.1  96 LIKELADKNRELRQMKGEELEGLSLEKLQQIEKRLEAGLTHVLEIKGTKIMDEITKLQRKGAVLMEENKQLKQKMA 171
                     333333344999*************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006630.053161IPR002100Transcription factor, MADS-box
SMARTSM004326.2E-39160IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-27323IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.01E-30375IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003197.2E-251057IPR002100Transcription factor, MADS-box
CDDcd002651.32E-331277No hitNo description
PRINTSPR004045.7E-272338IPR002100Transcription factor, MADS-box
PRINTSPR004045.7E-273859IPR002100Transcription factor, MADS-box
PROSITE profilePS5129712.62186176IPR002487Transcription factor, K-box
PfamPF014861.2E-1395170IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MAREKIKIKK IDNITARQVT FSKRRRGLFK KAAELSVLCD AEVALIIFSA TGKLFEYASS  60
SMEDILGKYK LHSSSLEKDD QPSLDLQLEN SLNMKLIKEL ADKNRELRQM KGEELEGLSL  120
EKLQQIEKRL EAGLTHVLEI KGTKIMDEIT KLQRKGAVLM EENKQLKQKM AMMNEGELPL  180
LTDLDCMVME EGQSSDQSIT TNVSTSGPPP EDDCSNAFLK LGCNNGPPIE DDCSDTSLKL  240
GLPFN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P1e-20173173Myocyte-specific enhancer factor 2B
1tqe_Q1e-20173173Myocyte-specific enhancer factor 2B
1tqe_R1e-20173173Myocyte-specific enhancer factor 2B
1tqe_S1e-20173173Myocyte-specific enhancer factor 2B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankFN3564421e-107FN356442.1 Witheringia solanacea mRNA for MPF2-like (M202 gene), allele WIsoM202_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016498400.11e-178PREDICTED: MADS-box protein AGL24-like
RefseqXP_016498401.11e-178PREDICTED: MADS-box protein AGL24-like
SwissprotQ9FVC17e-84SVP_ARATH; MADS-box protein SVP
TrEMBLQ9ATF01e-139Q9ATF0_PETHY; MADS-box transcription factor FBP13
STRINGPGSC0003DMT4000242471e-110(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9382377
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G22540.12e-76MIKC_MADS family protein