PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016497209.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family LBD
Protein Properties Length: 193aa    MW: 21686.5 Da    PI: 6.8884
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016497209.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601345.6e-4228126199
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+l+r+C+++C +apyf +++pkkfanvhk+FGasnv+k+l+++pe++red+++slvyeAe+r+rdPvyG++g i +lq+++ +l+++l 
  XP_016497209.1  28 SCAACKFLKRRCTPNCQFAPYFRSDEPKKFANVHKVFGASNVSKILNEVPEDQREDTVNSLVYEAEVRLRDPVYGCIGAIASLQRKMVELQHDLM 122
                     6********************************************************************************************99 PP

          DUF260  96 llke 99 
                     l+++
  XP_016497209.1 123 LART 126
                     8875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.50127128IPR004883Lateral organ boundaries, LOB
PfamPF031953.7E-4128125IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 193 aa     Download sequence    Send to blast
MSSQNHIKVK FEEKAEGMKS NEPRSSSSCA ACKFLKRRCT PNCQFAPYFR SDEPKKFANV  60
HKVFGASNVS KILNEVPEDQ REDTVNSLVY EAEVRLRDPV YGCIGAIASL QRKMVELQHD  120
LMLARTRVAY FAAKQNPTTN CSLMLDYDPF NVANVMPSDF ADVPVTAGYL DSYVQNSFDM  180
GHCASTNEFG QFP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A7e-47231326115LOB family transfactor Ramosa2.1
5ly0_B7e-47231326115LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016497209.11e-144PREDICTED: LOB domain-containing protein 21-like
SwissprotQ9SRL81e-61LBD21_ARATH; LOB domain-containing protein 21
TrEMBLA0A1S4C8C51e-143A0A1S4C8C5_TOBAC; LOB domain-containing protein 21-like
STRINGXP_009786680.11e-130(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4324669
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G11090.15e-64LOB domain-containing protein 21
Publications ? help Back to Top
  1. Weber AP,Weber KL,Carr K,Wilkerson C,Ohlrogge JB
    Sampling the Arabidopsis transcriptome with massively parallel pyrosequencing.
    Plant Physiol., 2007. 144(1): p. 32-42
    [PMID:17351049]