PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016495105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family CO-like
Protein Properties Length: 336aa    MW: 37460.9 Da    PI: 6.0532
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016495105.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box22.62.2e-071043336
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    +++C+ ++   ++ fC+ +  +lC +C +++H  
  XP_016495105.1 10 AKRCDSCKATAATVFCKADMAFLCLSCDSKIHAA 43
                    579******99*********************54 PP

2zf-B_box24.45.9e-085395339
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htv 39
                     ++C+ +e+ +++  C+ +   lC +C + +H+       H++
  XP_016495105.1 53 VWVCEVCEHAPASVTCKADAAALCVTCDQDIHSAnplarrHDR 95
                    689*****************************65777777776 PP

3CCT69.96.4e-24272315144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+Ae+RpR+KGrF+k++
  XP_016495105.1 272 REARVLRYREKRKNRKFEKTIRYASRKAYAETRPRIKGRFAKRT 315
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003366.2E-12855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.153855IPR000315B-box-type zinc finger
CDDcd000212.41E-71255No hitNo description
PROSITE profilePS5011910.6375198IPR000315B-box-type zinc finger
PfamPF006435.1E-65397IPR000315B-box-type zinc finger
CDDcd000211.21E-85498No hitNo description
SMARTSM003362.0E-105698IPR000315B-box-type zinc finger
PROSITE profilePS5101716.787272314IPR010402CCT domain
PfamPF062034.9E-18272314IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 336 aa     Download sequence    Send to blast
MVAESWSATA KRCDSCKATA ATVFCKADMA FLCLSCDSKI HAANKLASRH ARVWVCEVCE  60
HAPASVTCKA DAAALCVTCD QDIHSANPLA RRHDRFPIVP FYDSASTKSR GADEINPPPP  120
ETEEEAEAES WLLQAPNNNA QGIEYKSAEY LFSDVDPYVE MDMITDQKPC TDIQLHVQEY  180
KDDCVVPHVQ NKNEIHLQGP VVNGYPTYEM DFSGSKPFMY NFSSQSISQS VSSSSMEVGV  240
VPDHNTMADV SNTFVRNSST DGLPNPLSNL DREARVLRYR EKRKNRKFEK TIRYASRKAY  300
AETRPRIKGR FAKRTENEVD SLIASSDASY GVVPSF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016495105.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 4-like isoform X1
SwissprotQ940T92e-95COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A1S4C1S60.0A0A1S4C1S6_TOBAC; zinc finger protein CONSTANS-LIKE 4-like isoform X1
STRINGXP_009604722.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.11e-94CONSTANS-like 4