PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494689.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 737aa    MW: 81630.3 Da    PI: 7.0427
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494689.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.62.5e-095365682254
                     SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  22 nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     ++yp+ +++  LA+++gLt +qV++WF N R +
  XP_016494689.1 536 HPYPTDSDKHMLATQTGLTRNQVSNWFINARVR 568
                     89*****************************87 PP

2BELL101.65.7e-33390455671
            BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                      +kkakL+ +++e+++rYkqy++q+q+v+ssFe+vagl +a+pY+slAlk iS+hFr+L++ i++ 
  XP_016494689.1 390 LQKKAKLIYMQDEICRRYKQYHQQMQMVVSSFETVAGLSAATPYISLALKSISQHFRSLRNSISDN 455
                     57*************************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.1E-47310454IPR006563POX domain
PfamPF075268.5E-41315453IPR006563POX domain
PROSITE profilePS5007111.823509572IPR001356Homeobox domain
SMARTSM003896.2E-9512576IPR001356Homeobox domain
CDDcd000862.79E-11512573No hitNo description
SuperFamilySSF466898.13E-17514578IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.8E-28515576IPR009057Homeodomain-like
PfamPF059207.3E-18529568IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 737 aa     Download sequence    Send to blast
MSDQTSEFHV AQQSRRERLR FNSEQGIQPY QYGNISYDPS VLSTEMFNFG TSTEPVVVSN  60
KDTMMMHNLE LRAASDRLDH RVSHDVTQNC SNWKSVDLQQ TGNCNWNNVG NYSSGSGVVI  120
ESNLSTPMFV EDQGLSGSLN LNNVSTIDVK PNFFDYQEIQ HSPMTNSSSN MQFSSTSVLY  180
HDTLQEVVTS ATVGTQGVEM VGRGSWTESG NELLLLPNYV DHSRPLHVKN SSDLVSRPVE  240
RCHQWISCEL GTNVSTNSTA PDNSNAQALA LSLSPVPTSK TNMVQMEKRN PLSENFAIAH  300
RSAVPLGPFT GYATILKSSK FLRPAQQLMD ELCNLAAGSN AVKSCIFSKK VREGGVRVSC  360
DGNAAESSSG AIVGDSGGSS AESNGRPDYL QKKAKLIYMQ DEICRRYKQY HQQMQMVVSS  420
FETVAGLSAA TPYISLALKS ISQHFRSLRN SISDNLKNIR QALGEDLPSP ATTGMSKGDG  480
TSSKMKFIDQ NLHKQKAGGA GVAFFESQQH VWRPQRGLPE RAVAILRAWL FDHFLHPYPT  540
DSDKHMLATQ TGLTRNQVSN WFINARVRVW KPMVEEIHTL ETKGLGDQTG SSIRRSEGKL  600
VTERPNQVND GLHRSSISIS NCGQHFNVLN MSGMSEKQDD CPGIGPSERL DEDMLWKNQE  660
KRSRLECHIP ASMDGSLMGF VPYQRNGLEI GGIGAVSLTL GLRQNAEAAQ QQQQLQQLHE  720
HRLRQQFGGQ MIHDFVD
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B3e-16518575158Homeobox protein Meis1
4xrs_A3e-16518575158Homeobox protein Meis1
3k2a_B3e-16518576563Homeobox protein Meis2
3k2a_A3e-16518576563Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJN3936515e-99JN393651.1 Nicotiana tabacum clone Yun85-7 methylation-sensitive amplification polymorphism fragment genomic sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494689.10.0PREDICTED: uncharacterized protein LOC107813887
TrEMBLM1AE490.0M1AE49_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000208250.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA87202227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27990.12e-87BEL1-like homeodomain 8