PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016494286.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family TALE
Protein Properties Length: 668aa    MW: 72168 Da    PI: 6.8631
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016494286.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.2e-094534901954
                     HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
        Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                     Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  XP_016494286.1 453 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 490
                     664559******************************88 PP

2BELL122.41.9e-39314385172
            BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                     +r e+q++k+kLls+l+eVd+rY++y+eq+q+v++sF+ v+g g+a pYt+lA+ka+SrhFrcLkdai+ q+
  XP_016494286.1 314 DRIEHQRRKVKLLSMLDEVDRRYNHYCEQMQMVVNSFDLVMGFGAAIPYTALAQKAMSRHFRCLKDAITAQL 385
                     589******************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.7E-80240383IPR006563POX domain
PfamPF075268.1E-54245382IPR006563POX domain
PROSITE profilePS5007112.568431494IPR001356Homeobox domain
SMARTSM003891.2E-9434498IPR001356Homeobox domain
CDDcd000866.01E-13434495No hitNo description
SuperFamilySSF466892.99E-17435501IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.7E-29437500IPR009057Homeodomain-like
PfamPF059203.3E-18451490IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 668 aa     Download sequence    Send to blast
GLPVYDQTAG MLSEMFSFPP GTSSELLEAQ FNPNYRHPNP KIPPPAGMGN EWFGNRQGMV  60
VPLGYAKNHN NQISSAGINA AESMQLFLMN PQPRSPSPSP SHPPPPPSTN SSTLHMLLPN  120
PSSTSTIEGF PNPAEGSFGQ FTWGNNGGAS ASLNTPNEIG AGVNHVVESQ GLSLSLSSSL  180
QHKVEELRMG EESGMLFFNQ GGGGSTTSGQ FRYKNLNIGN SGVVGQNIHQ QVHVGYGSSL  240
GVVNVLRNSK YAKAAQELLE EFCSVGRGKF KKNNKATAAN PNSNNPSGGT NGGGGNNNTS  300
SSSSKDLPPL SAADRIEHQR RKVKLLSMLD EVDRRYNHYC EQMQMVVNSF DLVMGFGAAI  360
PYTALAQKAM SRHFRCLKDA ITAQLKHSCE LLGDKDAGTS GLTKGETPRL KMLEQSLRQQ  420
RAFHQMGMME QEAWRPQRGL PERSVNILRA WLFEHFLHPY PSDADKHLLA RQTGLSRNQV  480
SNWFINARVR LWKPMVEEMY QQEAKEEEEE DDERENSQNQ NSGNNAQTPT PNMSNSSSTN  540
MTTTTTALGA AAAAAETGTA ATATTATAAS TLGKRSEINA PENDPSLVAI NSHISFSENQ  600
ATFPTNIHDS DAAACRRGGK FFGDDYGTTT NADVGSTMIR FGTTSGDVSL TLGLRHAGNL  660
PENTHFFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A6e-17440497158Homeobox protein Meis1
4xrs_B6e-17440497158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4066990.0AF406699.1 Solanum tuberosum BEL1-related homeotic protein 13 (Bel13) mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016494286.10.0PREDICTED: BEL1-like homeodomain protein 2, partial
SwissprotQ9SW801e-167BLH2_ARATH; BEL1-like homeodomain protein 2
TrEMBLK4BCE50.0K4BCE5_SOLLC; Uncharacterized protein
STRINGSolyc02g089940.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33412139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.21e-137BEL1-like homeodomain 2