PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493830.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 379aa    MW: 41503.2 Da    PI: 8.6856
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493830.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC79.53.2e-25153196144
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                     d+epgrCrRtDGKkWRCsr+v++g+k+CErH+hrgr+rsrk++e
  XP_016493830.1 153 DPEPGRCRRTDGKKWRCSRDVVSGHKYCERHVHRGRNRSRKPVE 196
                     79***************************************987 PP

2QLQ45.91.7e-1680115136
             QLQ   1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                     s+F+ aQ+q+L+ Q+l+y++++a++PvP eLl  ++
  XP_016493830.1  80 SYFSLAQWQELELQALIYRHMLAGAPVPLELLHLVK 115
                     79*****************************97776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009514.2E-880116IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.49881116IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088805.6E-1281114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.911153197IPR014977WRC domain
PfamPF088793.0E-21154196IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 379 aa     Download sequence    Send to blast
MDFNLKQWKN QQQQNESEEE IPIPCAKLPR LVLDLDSSFS HSASDSALPL FVSEPTKLSA  60
YPLSSDSNST PTKFTRMGSS YFSLAQWQEL ELQALIYRHM LAGAPVPLEL LHLVKKSLIT  120
SSPYNYLPQS FQQYHHYQQA LVQSGYWGRT GMDPEPGRCR RTDGKKWRCS RDVVSGHKYC  180
ERHVHRGRNR SRKPVEITTM AAPVPAGGVN TANSGGSEVL NASAPHFTLS GTSPSIDLLH  240
LNQRPSESTI EKKGPLEVQN DVTGDGKSSS QILRCFFDDW PRQLEEGNNA RSNGSSVASA  300
TSLSISMPGN PSSDFSLKLS TGDRQKSGAR VTTWGTNQVT SMGGPLAEAL RSSTSNSSPT  360
SVLHQLPRGS TSEASYVST
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator that plays a role in the regulation of cell expansion in leaf and cotyledons tissues. Component of a network formed by miR396, the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation. {ECO:0000250}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: microRNA 396 (miR396a or miR396b) negatively regulates growth-regulating factors (GRF1-4 and GRF7-9). {ECO:0000269|PubMed:15200956, ECO:0000269|PubMed:19453503, ECO:0000269|PubMed:20023165}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016493830.10.0PREDICTED: growth-regulating factor 3-like
SwissprotQ8L8A78e-85GRF4_ARATH; Growth-regulating factor 4
TrEMBLA0A1S4BY560.0A0A1S4BY56_TOBAC; growth-regulating factor 3-like
STRINGXP_009599016.10.0(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA32832138
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G52910.13e-62growth-regulating factor 4
Publications ? help Back to Top
  1. Kuijt SJ, et al.
    Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors.
    Plant Physiol., 2014. 164(4): p. 1952-66
    [PMID:24532604]
  2. Cao Y,Han Y,Jin Q,Lin Y,Cai Y
    Comparative Genomic Analysis of the GRF Genes in Chinese Pear (Pyrus bretschneideri Rehd), Poplar (Populous), Grape (Vitis vinifera), Arabidopsis and Rice (Oryza sativa).
    Front Plant Sci, 2016. 7: p. 1750
    [PMID:27933074]