PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493539.1
Common NameAG1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MIKC_MADS
Protein Properties Length: 248aa    MW: 28664.3 Da    PI: 9.8855
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493539.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF99.31.6e-312574150
                    S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
          SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                    krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fss+g+lyey+
  XP_016493539.1 25 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSSRGRLYEYA 74
                    79***********************************************8 PP

2K-box1157.3e-38931894100
           K-box   4 ssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98 
                     s++ s +ea+a+++qqe++kL+++i nLq+++R++lGe+L  Lsl++L++Leq++ek+++kiRskKnell+++ie++qk+e +l+++n++Lr+k+
  XP_016493539.1  93 SNTGSISEANAQYYQQEASKLRAQIGNLQNQNRNMLGESLAALSLRDLKNLEQKIEKGISKIRSKKNELLFAEIEYMQKREIDLHNNNQYLRAKI 187
                     4444599***************************************************************************************9 PP

           K-box  99 ee 100
                     +e
  XP_016493539.1 188 AE 189
                     86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.4E-411776IPR002100Transcription factor, MADS-box
PROSITE profilePS5006633.6691777IPR002100Transcription factor, MADS-box
CDDcd002652.20E-451894No hitNo description
SuperFamilySSF554553.27E-331890IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-331939IPR002100Transcription factor, MADS-box
PROSITE patternPS0035001973IPR002100Transcription factor, MADS-box
PfamPF003199.3E-272673IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-333954IPR002100Transcription factor, MADS-box
PRINTSPR004044.6E-335475IPR002100Transcription factor, MADS-box
PfamPF014862.0E-27101187IPR002487Transcription factor, K-box
PROSITE profilePS5129715.263103193IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 248 aa     Download sequence    Send to blast
MDFQSDLTRE ISPQRKLGRG KIEIKRIENT TNRQVTFCKR RNGLLKKAYE LSVLCDAEVA  60
LIVFSSRGRL YEYANNSVKA TIERYKKACS DSSNTGSISE ANAQYYQQEA SKLRAQIGNL  120
QNQNRNMLGE SLAALSLRDL KNLEQKIEKG ISKIRSKKNE LLFAEIEYMQ KREIDLHNNN  180
QYLRAKIAET ERAQQQQQQQ QMNLMPGSSS YELVPPPHQF DTRNYLQVNG LQTNNHYTRQ  240
DQPSLQLV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1tqe_P9e-211785169Myocyte-specific enhancer factor 2B
1tqe_Q9e-211785169Myocyte-specific enhancer factor 2B
1tqe_R9e-211785169Myocyte-specific enhancer factor 2B
1tqe_S9e-211785169Myocyte-specific enhancer factor 2B
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in regulating genes that determines stamen and carpel development in wild-type flowers. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankTOBNAG1A0.0L23925.1 Nicotiana tabacum NAG1 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009586722.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X2
RefseqXP_009586723.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X3
RefseqXP_016493539.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X1
RefseqXP_016493540.10.0PREDICTED: floral homeotic protein AGAMOUS isoform X2
SwissprotQ435850.0AG_TOBAC; Floral homeotic protein AGAMOUS
TrEMBLE3UT601e-168E3UT60_CAPAN; AGAMOUS-LIKE2
STRINGPGSC0003DMT4000731341e-166(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA4024625
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G18960.11e-123MIKC_MADS family protein
Publications ? help Back to Top
  1. Kempin SA,Mandel MA,Yanofsky MF
    Conversion of perianth into reproductive organs by ectopic expression of the tobacco floral homeotic gene NAG1.
    Plant Physiol., 1993. 103(4): p. 1041-6
    [PMID:7507255]