PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016493536.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRF
Protein Properties Length: 349aa    MW: 39031.4 Da    PI: 7.7984
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016493536.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.42.9e-2478122145
             WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                     d+epgrCrRtDGKkWRCs+++++++k+CErH++rgr+rsrk++e+
  XP_016493536.1  78 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMNRGRNRSRKHVES 122
                     79****************************************986 PP

2QLQ64.52.6e-221752237
             QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                    +FTa Q+q+L++Q+++yKyL+a+ PvPp+L+++i++
  XP_016493536.1 17 PFTAVQWQELEHQAMIYKYLVAGIPVPPDLVVPIRR 52
                    9*********************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.5E-131652IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.8841752IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.7E-161751IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.9878122IPR014977WRC domain
PfamPF088792.6E-2079121IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 349 aa     Download sequence    Send to blast
MSGTTMRTVA EDGYRPPFTA VQWQELEHQA MIYKYLVAGI PVPPDLVVPI RRSFEAISAR  60
FFHHTSLGYC SYYGKKFDPE PGRCRRTDGK KWRCSKDAYP DSKYCERHMN RGRNRSRKHV  120
ESQSTSQSLL TSMSNNATGS SKTSGNFQSS SSGSLQNMPL YSAAYSEGPN YGSTGTKMQM  180
EPVSYGIDNK AYRYFHGMAA DADEQNFSLE ASASMRSLGM GSNADSTWCL TPQLPSNPMV  240
KPKNETQLLY GSPQTRLPHP FEPMIDATIS KQQQHCFFDS DIGSPGTVKQ EERSMRPFFD  300
EWPTAKESWS NLDDEGSIKN NFSSTQLSIS IPMAPSESFS RSSCSPNDV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009790531.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_009790532.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_016493536.10.0PREDICTED: growth-regulating factor 4-like isoform X1
RefseqXP_016493537.10.0PREDICTED: growth-regulating factor 4-like isoform X1
TrEMBLA0A1S4BXA40.0A0A1S4BXA4_TOBAC; growth-regulating factor 4-like isoform X1
TrEMBLA0A1U7XLP50.0A0A1U7XLP5_NICSY; growth-regulating factor 4-like isoform X1
STRINGXP_009790531.10.0(Nicotiana sylvestris)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA7432384
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-50growth-regulating factor 5